KEGG   Brassica oleracea (wild cabbage): 106315350Help
Entry
106315350         CDS       T04124                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 1 isoform X1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00430  Taurine and hypotaurine metabolism
boe00460  Cyanoamino acid metabolism
boe00480  Glutathione metabolism
boe00590  Arachidonic acid metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106315350
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    106315350
   00460 Cyanoamino acid metabolism
    106315350
   00480 Glutathione metabolism
    106315350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:boe01002]
    106315350
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:boe04090]
    106315350
Enzymes [BR:boe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     106315350
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     106315350
    3.4.19.14  leukotriene-C4 hydrolase
     106315350
Peptidases and inhibitors [BR:boe01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   106315350
CD molecules [BR:boe04090]
 Proteins
  106315350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 106315350
NCBI-ProteinID: XP_013608538
UniProt: A0A0D3A0Z5
Position
C1
AA seq 575 aa AA seqDB search
MNSMPLVRTALIALFLVAFLQNAAAQKRPQSIVKSRGAVATDDGRCSGIGMSVLRQGGNA
IDASVAAALCLGVVSPASSGIGGGAFTVVKIAGGKAIAYDSRETAPLGATEDMYGSNPDL
KKKGALSAGVPGEVAGLFTAWKQHGKLPWKQLVTPAEKLAEGFRISKYLYMQMNATRVDI
LADKGLSELFVSNGELKKPGTIIHNTALAFTLKQIGEYGPKAFYNGTVGVNLARDIRKAG
GIITLKDLQSYRVKVTKPLSANILGYELLGMPPPSSGGAAMMLVLNILSQYGIPSGVSGS
LGVHRLIEALKHAFAIRMNLADPDFVDVTKVVSDMLSPEFAKDLKKKINDDKTFDPKYYG
GMWNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSTSTGIVLNNEMDDFSVPAKS
RGDVNVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTIEVFLNHF
FLHMDPLSSVLAPRIYHQLIPNRASFENWTTMFNDHFEVPKEIRVVLEKKGHVLTPVAGG
TIAQFIVQESDGSSGGMSKLVAVSDPRKGGFPSGY
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaatgccactggttcggacagcgttgatcgctctttttctagtcgcttttctg
caaaacgctgcggctcagaaaagaccgcaaagtattgttaagtctcgtggtgcggttgca
actgacgatgggcggtgttctgggatcgggatgagtgtacttcgacaaggaggaaacgct
attgatgcgtcggtggccgctgctctctgtttaggcgttgtgagtccagcctctagcggt
ataggaggcggagcgtttacagtggttaagatagctggcgggaaggctatcgcttatgat
tctagagaaacagctcctctcggcgccactgaggatatgtatggaagcaatcctgatcta
aagaagaaaggagccttatcagcaggcgttccaggggaagtcgcgggtcttttcacagct
tggaaacaacacggaaagctcccatggaagcagttagtgactcctgcagagaaactcgca
gaaggattcagaatttcaaagtatctctacatgcagatgaacgccacaagagtcgatatc
ttggcagacaaaggtctctctgagctatttgtttcaaatggagagctcaagaaaccaggg
accattatccataacacagcattagcatttacactcaagcaaatcggtgaatatggtcca
aaagcattttacaatggcacggtgggggttaacctggctagagatattcgtaaagctggt
gggataataactttgaaagatctgcaaagttatagagttaaggttaccaaaccgttgtct
gcaaacattctcgggtacgaactactcggtatgcctcctccttcatcaggtggtgctgca
atgatgcttgttctgaacattctttctcaatatgggattccttcaggtgtttctggctct
ctaggtgttcatcgactaatcgaagctctgaaacacgctttcgcgattaggatgaacctt
gctgatccagattttgtagatgttaccaaggttgtttcagatatgttgtctccggaattt
gcaaaagacttgaagaagaagataaacgatgataaaacctttgatccaaaatattatggc
ggcatgtggaatcaaatagacgatcatggtacaagtcatttatcaatcatagatcgcgag
aggaacgctgtttcgatgactagtacaataaacggttactttggggcagtgatgctatct
actagcaccggaatcgttctaaacaacgagatggatgatttttcggtcccagcgaagtcc
agaggtgacgtaaatgtgccgccaccggcaccagctaacttcatcagacccgggaaacga
ccattgtcctcaatgtcacccaccattgtactcaaggacggtaaagtgaaagctgcggtg
ggtgctagcggtggagcgaacatcattgccgggacaattgaagttttcttgaatcatttt
ttcctccatatggatcctctttcttccgtcttggctccaagaatctaccatcagctgata
ccaaacagagcttcgtttgaaaattggacgacaatgttcaatgatcatttcgaggttcct
aaagagataagagttgtgttggaaaagaaaggtcatgttctaacgccagtcgccggaggg
acgattgctcagttcatagttcaagaatctgatgggagttccggcggaatgagtaagctt
gtggcagttagtgatccaaggaaaggagggttcccctcgggatattga

DBGET integrated database retrieval system