KEGG   Brassica oleracea (wild cabbage): 106315897Help
Entry
106315897         CDS       T04124                                 

Definition
(RefSeq) putative uncharacterized protein At4g01020, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106315897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:boe03041]
    106315897
Enzymes [BR:boe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106315897
Spliceosome [BR:boe03041]
 Complex C
  Other components
   Step II factors
    106315897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4 DEAD AAA_22 zf-RING_2 zf-RING_5 Helicase_RecD zf-C3HC4_3 AAA_19 DUF2075 AAA_30 ABC_tran AAA_29 Secretin_N RsgA_GTPase KH_1
Motif
Other DBs
NCBI-GeneID: 106315897
NCBI-ProteinID: XP_013609189
UniProt: A0A0D3EGH5
Position
C9
AA seq 1769 aa AA seqDB search
MRSSLPQPNSGRRSTTNRRWSLPSASPNPSYNSRSAHSSRPLSHQPTQSHHRSNFPPNHR
PDRAQPTRIKPNFIVQLVHPRTAAANTNTNTNPSFSVRKQAIITLASLCGIPEESVHVPQ
LGSVAGSFGFRQWTNALSAVVSLWDHRLRGKHDFVPELVPNVVVPSDVDELRDRLRDLFS
SHVLSLVENGESVKKVRREIDEKSRRAESFDSKRGIRLEVFEMKKALEAERDLVVKRLEE
FKNAMMWIVRFLKRSDDGLEVDDVDVFSLEGDYDWPRVHSLIRRECRRLDDGLPIYAYRR
NILKKVYGQQVTVLIGETGSGKSTQLVQFLADSGVASSESIVCTQPRKIAALTLADRVRE
ESNGCYEEDSVRAFSSAEKFSSKVVFMTDNCLLQHYIKDRSLPGVSCVIIDEAHERSLNT
DLVLALLKDLLCKRVDLRLVIMSATADAYQLSEYFFGCEILRVAGRNFPVEIIYTPGSDT
EGTSVVGRVAPYADDVVKKAMEVHRTERDGTILAFLTSQAEVEWACERFIAPSAVALPLH
GKLSFEEQFRVFQSHHGRRKVIFATNIAETSLTIPGVKYVIDSGMVKESKYEARTGMSIL
KVCRVSKSSAQQRAGRAGRTEAGRCYRLYSKHEFTSMSLNQEPEIRRVHLGVAILRILAL
GVDNIADFDFIDAPDPEAVVMAVKNLVQLGAVVEKNGVLELTQEGHCLVKLGLEPKLGKL
ILGCFRHRMGKEGIVLAAVMANASSIFCRVGNLDDKMKADCLKVKFCNNNGDLFTLLSVY
KEWASLPRERRNKWCWENSLNAKSMRRCEDTVKELEICIERELSLVSPTYWVWNSTEGND
KHEKHLKMVILASLAENVAMYTGYDQLGYEVALTGQQVQLHPSCSLLAFGQKPNWVVFGE
LLSAVDQYLVCVTAFDFEALSMLDPPPPFDASHMDEWRLRVKKVAGCSSTLLKRFCGKSN
RSLLSIVSRARPLCEDERINIQVDVDQNEILLYAPPHDMDKVLSLVNDALECEKKLMRNE
CFEKYIYHGRGEVPLALFGSGAQIKHLEVDQRFLTVDVLYYGDNSLDDREILTFLEKEID
GCICSIHKFAGNKQDCDEKEKWGRVTFRTPESAMKATEIQKFDLNGSVIKLFPSLSAGGE
GVFKMPSVTAMIRWPQRESCGKGVLKCASGDIHSIFAGSSGIMIGTKYCPFETDQRHTDS
ILITGIDTNLSDAEVLDVLEFATQRTDLEFFLFRRGNIVHCQDLTVCKDMLHKRIFARLS
SRNPDPKCVEVKVFEPKEANFVRALITFDGRLHLEAAKALQELDGTILDGCYPWQKIKCE
QKFQSSIICPAFIYNIVRRQLYAKLASFKRQRKCEWHLEAIHSGAYRVKISANATRRISE
MRRSLEELIRGRPIINHPGLTPRVLQHLLSREGVILMRKIQQETETCIVVDRQSLAVRIC
GSEERTAAAEQELVRSLLAYHESKQLEIRLRGPNLRPDLMKEVVNRFGPELQGIKEKVNG
VDLKLNTRYHVIHVHGSVEMRQEVEKMVYELAREEGSALGGTKPDEIEVECPICLSEVED
GYSLEGCSHLFCKACLLEQLEASMRNFDAFPIICSHIDCGAPIVLADMRALLSQEKLDEL
FRASLSSFVTTSDGEFRFCSTPDCPSIYRVAGPLDSGEPFFCGACNSQTCTRCHLEYHPY
ITCERYKLFKEDPDMSLKDWAKGKNVKECPCCKSTIEKSEGCNHLLCRCGNHICWVCLRW
FAQQEPCYEHLRGVHGGIGLFDELGMPML
NT seq 5310 nt NT seq  +upstreamnt  +downstreamnt
atgaggagttcacttcctcagcccaacagtggaagaagatccacgactaatcgtcgatgg
tcacttccctcagcttcccccaacccttcttataactctcgctccgctcactcttctcgg
cccctcagccaccagcctactcaaagccaccaccgctccaatttcccgccaaatcacagg
cccgatcgggcccaaccgactcgtattaagcccaatttcatcgtccagctcgttcaccca
agaaccgccgccgccaacaccaacaccaacaccaatccctctttttccgttagaaagcaa
gcgatcatcacactcgcttctctctgcggaatccccgaggagtccgtacacgtcccccag
ctcggctccgtcgccgggagcttcggtttccgccaatggaccaacgcgctctccgccgtc
gtgtctctctgggaccatcgcctccgagggaagcacgatttcgtccccgagctggttccc
aacgtcgtcgtcccgtccgacgtggacgagcttagagacaggctccgcgatctcttctcg
tctcacgttctctcccttgtggaaaacggagagagcgtgaagaaggtgagacgcgagatt
gatgagaagtctcgtcgagctgagtcctttgattccaaaaggggtattaggttagaggtg
tttgagatgaagaaggctttggaggcggagagggatttggttgtcaagcggcttgaagaa
ttcaagaacgctatgatgtggattgtgcggtttctcaaaagaagtgatgatggattagaa
gttgatgacgtggacgtgtttagtttagaaggggactatgattggccacgtgttcatagt
ttaatccgtagggagtgtcgaaggcttgatgatgggctgcctatctatgcttaccggcgg
aatattttgaagaaagtttatggccaacaggtaacggtattgattggagaaactggttca
gggaagagcactcagttagttcagtttcttgctgactccggagttgcgtccagtgagtct
atcgtttgtacacagccaaggaaaatcgctgcattgacattggctgatcgagtcagagaa
gaaagcaatggttgttatgaggaagattctgtccgagctttctcttctgcggagaagttt
agttccaaagttgttttcatgacggataactgtctgcttcaacactacatcaaagatcgg
agtttgcctggcgtttcgtgcgttattattgacgaagcacatgaaagaagcttaaacacg
gacctggttttggcgttgctcaaagatctgctgtgcaaaagagttgacttaaggcttgtc
atcatgtccgccacggccgatgcttaccagctttcagagtatttctttggctgtgagatt
ctccgtgtcgcgggaaggaactttccggtggagattatatatacacctggtagtgacacg
gaagggacttctgttgttggccgcgttgctccatatgctgatgatgttgtaaagaaggcg
atggaagtgcatagaacagagagagatggaaccatccttgcattcttgacttcccaagca
gaggtagagtgggcatgcgaaaggtttatagctccatctgctgtcgctttgcctttgcat
ggaaagctatcttttgaagaacagtttagggttttccagagccatcatgggagacggaaa
gtgatatttgccacaaatattgcggagacctctctaactattcctggcgtcaagtatgtg
attgattccgggatggtgaaagagagcaaatacgaggctagaacgggtatgagcatcctc
aaggtttgcagagtcagtaaaagttcagctcagcaacgcgctggtcgtgctgggaggaca
gaagctgggagatgttacagactctactcaaaacacgagtttacttccatgagtcttaat
caggagcctgagattcggagggttcatctcggtgtagcgattttgaggattcttgctctg
ggtgtagacaacatagcggattttgattttatcgacgcgcctgaccctgaagccgtcgtg
atggctgtcaaaaaccttgttcagttgggtgcagtcgttgagaagaatggtgttcttgag
ttaacgcaggaaggacattgtttagtcaagctgggtctggagccaaagcttggtaagttg
attttgggatgcttcagacacagaatgggcaaagaggggattgttcttgctgctgtcatg
gccaatgctagtagtatattttgcagagttggtaaccttgatgataagatgaaagctgat
tgcctaaaggtgaagttctgcaacaataatggagacctcttcactcttctttcggtgtac
aaagaatgggcatctctgccgcgagagagaagaaacaaatggtgctgggaaaatagcctg
aacgccaaatcaatgaggagatgcgaagacacagtcaaggagctggagatatgcattgag
agagaactttctctcgtcagtccaacctactgggtttggaactcaaccgagggtaatgat
aaacacgagaagcatctgaaaatggttatacttgcgtctcttgccgagaacgtggcgatg
tacactggctatgatcagctcgggtacgaggtagcgttgactgggcaacaagtccagttg
catccgtcgtgttcgttgctagcgtttggccagaagccaaactgggttgttttcggtgag
cttctgtcagctgtcgaccagtacttggtatgtgtaaccgcgtttgatttcgaggctttg
tctatgcttgatccacctccaccttttgatgcatctcatatggatgagtggaggctcaga
gtgaaaaaggtggctggttgtagcagcactctgctgaaacgattctgtgggaaatctaac
cgtagtctgctttcgattgtctctcgcgctaggcctctttgtgaggatgagaggattaat
attcaagttgatgtagatcagaacgagattctactgtatgcgcctccccacgacatggac
aaagtgttgtccctagtgaacgatgcattggaatgcgaaaagaagttgatgcgtaacgaa
tgttttgagaagtatatatatcatggtcgaggagaagtaccccttgcactgttcggatcc
ggcgctcagataaagcatcttgaagttgatcagagattcttgacagtcgatgtactctat
tacggcgacaactctcttgatgacagagagattctgacgttcctggagaaggagatcgat
ggatgtatctgctccattcataagtttgctggtaacaagcaagactgtgatgagaaggag
aagtggggtagggttacctttcggactccggagtctgctatgaaggcaacagagattcaa
aagtttgatctcaacggatcagtgattaaactatttccatcgctgtcagctggtggtgaa
ggagttttcaagatgccttctgttacagctatgattcgttggccgcaaagggaaagttgt
ggtaaaggtgttcttaagtgtgcttctggtgatattcacagtatctttgctgggtcatcc
ggcatcatgataggaacaaaatattgcccctttgagacggatcaaagacacactgattct
attttgattactggtattgacacaaatctttcggatgctgaagttttagatgttttggag
ttcgctacgcagagaacagatttggaatttttcttattcagaagaggaaatattgtgcat
tgtcaagatcttactgtttgtaaagatatgctgcataagagaatatttgcgcgcttgtca
tcgaggaatccagacccaaagtgtgttgaagtcaaagtctttgaaccaaaagaagctaat
tttgtgcgagcgttgattacttttgatgggagattacatctggaagctgcaaaagctttg
caggagttagatggaactattctagatggatgctatccatggcagaagataaaatgcgag
caaaagtttcagagctccataatctgtcctgcttttatctacaacatagtcagaagacaa
ttatatgctaagctagcaagcttcaagagacaaagaaaatgtgaatggcatctggaggca
attcatagtggtgcttatcgtgttaaaatctccgcaaatgcaacaagacgcatctcggag
atgcggagatctctcgaagaactcataagaggaagacccataataaaccatccaggctta
accccaagggtcttgcagcatcttttgtccagagaaggtgttatcctgatgcggaagatc
caacaggagactgaaacttgcattgtggtagacaggcagagtctcgcagtacgcatttgt
ggatcagaagagagaaccgctgcggctgaacaagagctggttcggtcgcttctggcttat
cacgagagcaagcagcttgaaatccgcctccgaggtccgaatctccgtcctgatctcatg
aaggaagttgtgaatcggtttggtccagagctccaaggtattaaagagaaggtgaatggt
gtggatctcaagctcaacactcggtaccatgttattcatgttcatgggagcgtggagatg
aggcaggaagtagagaagatggtctatgaacttgcacgggaagaaggtagtgcactgggc
ggtactaaaccagatgagattgaagttgaatgccctatttgcttgtctgaggttgaggat
ggctactctctcgaaggatgttcacacctcttctgcaaagcttgtttgttggaacagctc
gaggcgtcgatgagaaactttgacgcatttcccataatctgttctcacatcgactgtgga
gctcctatagtacttgctgatatgagagccctcttatcacaagagaagctcgacgaactc
ttcagagcatccctctcctcttttgtaacaaccagcgatggtgagttccggttctgctcc
acacctgactgcccttccatctaccgcgttgccggtcctctagattcaggggagccattt
ttctgcggagcgtgtaactcacagacgtgcacgaggtgccacctggagtatcacccgtac
atcacttgcgaaaggtacaaactgttcaaggaggatcctgacatgtcgttgaaggactgg
gcgaaagggaagaacgtgaaggagtgtccgtgttgcaagtcgacgatagagaaatctgaa
gggtgtaaccatctgctgtgccggtgtgggaatcacatttgctgggtctgcttaaggtgg
ttcgctcaacaagaaccttgttatgaacatttgagaggagtccatggtgggataggcctc
ttcgatgagctaggcatgcccatgctttga

DBGET integrated database retrieval system