KEGG   Brassica oleracea (wild cabbage): 106315996Help
Entry
106315996         CDS       T04124                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00350  Tyrosine metabolism
boe00360  Phenylalanine metabolism
boe00380  Tryptophan metabolism
boe00901  Indole alkaloid biosynthesis
boe00950  Isoquinoline alkaloid biosynthesis
boe00965  Betalain biosynthesis
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106315996
   00360 Phenylalanine metabolism
    106315996
   00380 Tryptophan metabolism
    106315996
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    106315996
   00950 Isoquinoline alkaloid biosynthesis
    106315996
   00965 Betalain biosynthesis
    106315996
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:boe04147]
    106315996
Enzymes [BR:boe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     106315996
    4.1.1.105  L-tryptophan decarboxylase
     106315996
Exosome [BR:boe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106315996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5 RBD
Motif
Other DBs
NCBI-GeneID: 106315996
NCBI-ProteinID: XP_013609308
UniProt: A0A0D3E3M4
Position
C9
AA seq 490 aa AA seqDB search
MENGSRHVLKPMDSEQLREYGHRVVDFIADYYKTIESFTVLSQVQPGYLHNLLPDSAPDH
PETVEQVLDDVKTKILPGVTHWQSPNFFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSP
AATELEMIVLDWLAKLLNLPEHFLCKGNGGGVIQGSASEAILVVMIAARDKVLRSAGKNS
LGKLVVYSSDQTHSALQKACQIAGIHPENCRVLKADSSTNYALRPELLQEAVSRDLEAGL
IPFFLCGNVGTTSSAAVDPLAALGKIAKSNEIWFHVDAAYAGSACICPEYRQYIDGVETA
DSFNMNAHKWFLTNFDCSLLWVKDQHALTEALSTNPEFLKNKASQANLVVDYKDWQIPLG
RRFRSLKLWMVLRLYGAETLKNYIRNHIKLAKDLEQLVSQDPNFEVITPRIFSLVCFRMV
PIDDDENKCNSRNLELLEAVNSSGKLFISHTALSGKIVLRCAIGAPLTEEKHVKETWKVI
QEKASYLLRK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtagtaggcacgtgctgaagccgatggactctgagcaactgagagagtac
ggacatcgagtggtggacttcattgctgattattacaaaactatcgaatctttcactgtc
cttagccaagttcagcctggttatcttcacaaccttttgcctgattcagcaccagaccac
cctgaaacagttgaacaagttcttgatgatgttaaaacgaagatattgcctggagtaact
cattggcaaagccccaacttctttgcttattacccatctaacagcagcgttgcagggttc
ttgggtgagatgttgagtgctggtcttggaattgttggttttagttgggtcacttctcca
gctgccactgagctcgaaatgatcgttcttgattggcttgccaaacttctaaacctaccc
gagcattttctctgcaaaggaaatggaggtggagtcattcaagggtcagctagtgaagct
attcttgttgttatgattgctgcccgcgataaggtcttaagaagtgctggcaagaactcc
cttgggaagctcgttgtctactcctctgaccagacacattcagctttacagaaagcttgc
cagatagccggaatccatccggagaattgcagggtgctgaaagctgattcctctacaaat
tatgctctgcgtccagaattgcttcaagaagccgtttctcgagatcttgaagctggattg
attccattcttcttgtgtggcaatgttggaacaacttcttcagcagcagttgatccacta
gccgcactgggaaagattgcaaagagcaatgagatatggtttcacgtggacgcagcgtac
gctggaagtgcttgtatatgtccagagtatcgacagtacattgacggagtagaaactgca
gactcttttaacatgaatgctcacaaatggttcctcaccaacttcgattgttccctactt
tgggtgaaggatcagcatgctctcactgaagctctgtcaacaaatccagagtttctcaaa
aacaaggcctctcaggcaaacttagttgttgattacaaagactggcagatccctctcgga
cgaagattcagatcattgaaactatggatggttttaaggctctacggagctgagactttg
aagaactatataagaaaccacatcaaactggctaaagatcttgaacaactcgtctctcaa
gatcctaactttgaggttatcactcctcggatattttccctcgtctgtttccgtatggtt
cctattgatgacgacgaaaacaagtgtaatagtcgaaacctcgagctcctagaggcagta
aattcctcagggaaactcttcatttctcacactgctttgtcgggaaaaatcgttctacgt
tgcgccattggagcgccattgacagaggagaagcacgtgaaggagacatggaaggttatt
caggaaaaagcatcttacttgcttcgcaagtaa

DBGET integrated database retrieval system