KEGG   Brassica oleracea (wild cabbage): 106316796Help
Entry
106316796         CDS       T04124                                 

Definition
(RefSeq) short-chain dehydrogenase TIC 32, chloroplastic-like
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe01100  Metabolic pathways
Brite
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     106316796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-GeneID: 106316796
NCBI-ProteinID: XP_013610121
UniProt: A0A0D3E456
Position
C9
AA seq 348 aa AA seqDB search
MIETVKHLIGSGGPSGFGSRSTADHVTVNCDLRSLTAIITGATSGIGAETARVLAKRGAR
LVIPARSLKTAEETKSRILSEFPDAEIIVMHLDLSSLASVRRFVADFESLHLPLNILINN
AGKYAHKHAISEDGVEMTFATNYLGHFLLTKLLLKNMIETAAQTGVQGRIVNVTSVIHSW
FSGDMLQYLADISRNNRNYDATRAYALSKLANVLHTIELSRILHKMDANVTANCVHPGIV
RTRLTRDREGLITDLVFFLTSKLLKSVPQAAATTCYVATSPRLRNVCGKYFSDCNEARTS
KLGSCNIKAQRLWTASELLVSPASCTPHLYRTFKCSLTNDAICKSQAL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgattgagacggttaagcacctgattgggtccggtggcccaagcggattcggatccaga
tccacagccgatcatgtcactgttaattgtgatctccgatctctaacagcaatcatcacc
ggagcgacgtcgggaataggagcggagacggcgcgagttctggcaaagcgaggagcgagg
cttgtgattccggctcggagtctcaaaaccgccgaggaaacaaagtcacgtatcctctct
gagtttcctgatgcggagatcatcgtcatgcatcttgatctcagctcccttgcctccgtt
cgacgattcgtagctgatttcgaatctcttcatctccctcttaacatcctcatcaacaat
gctggaaaatacgcgcacaagcacgccatctctgaggacggcgtggagatgacattcgcc
actaattatctcggccattttctgctcactaagctgctgttaaagaatatgatcgaaacg
gcggcgcaaactggcgttcaaggccgcatcgtcaacgttacatcggtgattcacagctgg
ttctctggcgatatgttgcaatatctcgccgatatctcccgaaacaatagaaattacgac
gcgacccgagcttacgcgctctccaagctcgccaacgttctccacaccatagagctctcc
cggattctacataaaatggatgctaatgtaacggcaaactgtgttcatcctggaatcgtg
agaacacgtctcacacgtgaccgagaaggtctcatcactgatttagtctttttcttgacc
tccaagctattgaagtctgttcctcaggcagcagcaacgacttgctacgtggcaactagc
cccagattgaggaacgtgtgcggcaagtacttctcggactgcaacgaagctcggacatct
aaattgggatcgtgcaatattaaagctcagagactatggactgcttctgagttgctggtt
tctccagcttcctgtactccccatctttaccgaacatttaaatgctctttaaccaacgat
gctatatgtaaatcccaagccctgtaa

DBGET integrated database retrieval system