KEGG   Brassica oleracea (wild cabbage): 106316852Help
Entry
106316852         CDS       T04124                                 

Definition
(RefSeq) glutathione gamma-glutamylcysteinyltransferase 1-like
  KO
K05941  glutathione gamma-glutamylcysteinyltransferase [EC:2.3.2.15]
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106316852
Enzymes [BR:boe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.15  glutathione gamma-glutamylcysteinyltransferase
     106316852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phytochelatin_C Phytochelatin NHR2
Motif
Other DBs
NCBI-GeneID: 106316852
NCBI-ProteinID: XP_013610173
UniProt: A0A0D3E6D2
Position
C9
AA seq 492 aa AA seqDB search
MAVASLYRRSLTSPPAIDFSSTDGKNIFKEAVQKGTMEGYFSLISYFQTLSEPAFSGLAS
LSVVLNALSIDSDRKWKGSWRWFDESMLDCCESLEIVKEKGISFGKLVCLAHCSGAKVEA
FRTSHSTIDDFRKFVVACSISEKCHMISSYDRGVFKQTATSHFSPIGGYSAERDMALILD
VGRFKYPPHWVPLKLLWEAMDTIDQSTGKRRGFMLISRLHKDPGLLYTLSCKDESWISIV
KYLKEDVPRLVSSQHVDTVEKILSVVFKSLPSNFNTFIKWVAEIRRTEDAKPNLSAEEES
RQKLKRDELTQVHETELFEHVSKFLTSVGYEENLSFAAATACCQGAKVLSGCSSNEYYCR
ETSVKCIKGHGPSGVEEATVIAGVVVRDGSEQEVDLLVPSTQPVSKGSEYYSPESKYPSG
SDAFTALLMALPPQTWFGIKDQALQTKMKKLVSVGTFSTMHHEEVSHLRRQLIMLKRCQE
KKEEEDLTAPLS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcgagtttgtatcggcgatcacttacctctcctcctgcgattgacttttct
tctaccgatggcaagaatatattcaaagaagcggttcagaaaggaacaatggaaggatat
ttcagtttaatttcttatttccagacgctgtctgaacctgccttttctggtttggctagc
ctttcagtggtcttgaatgccctttccatcgattccgaccgaaaatggaaaggatcttgg
aggtggtttgatgaatcaatgctggattgctgcgaatctctggagatagtgaaagaaaaa
gggatttcatttggaaaacttgtgtgtttggctcattgttcaggagctaaagtggaagct
ttccgcacaagtcatagtaccattgatgatttcagaaaattcgtagtggcatgctccatt
tctgagaaatgccatatgatctcgtcatatgatagaggagtgtttaagcagactgcaact
tctcacttttcacctataggtggctatagtgctgaaagagacatggctctgattcttgat
gtcggtcgttttaagtatcctcctcactgggttcctcttaaacttctttgggaagccatg
gacaccattgatcagtcaacagggaaacgtagagggttcatgctcatttctagactccac
aaagacccaggattgctttatactctgagctgcaaagatgaaagttggatcagcatagtc
aagtatttgaaggaagacgttcctcgtcttgtaagttcacagcatgtagatactgttgaa
aaaatcttatcagttgtgttcaagtcccttccgtccaacttcaacacattcattaaatgg
gtggctgagatccgaagaacagaggacgcaaaaccaaatcttagtgcagaggaggaatca
aggcaaaagttgaagcgagatgaactgacgcaagtgcatgaaaccgaactgttcgagcac
gtgagcaagttcttaacctcagtgggctacgaagaaaatctatcattcgcagctgctacg
gcttgttgccaaggagccaaagtcttatccggatgctcatcaaacgagtactattgtcgc
gaaacttctgtgaaatgcatcaaaggtcatgggccttctggagtggaggaagccacagtt
atagccggagttgtggttcgtgacggtagtgaacaagaggttgacctattggtgccgtcg
actcaacctgtctcgaaaggaagtgaatattatagtccggagtcaaagtatccatcaggc
agcgatgcattcaccgcgcttctgatggctttacctccacagacatggtttggaatcaaa
gaccaagctcttcaaaccaaaatgaagaagctggtctccgttggcaccttctcgactatg
catcacgaagaggtatctcatcttaggagacaacttataatgctaaagcgatgccaagag
aagaaggaagaggaagacctcaccgctcctctctcttaa

DBGET integrated database retrieval system