KEGG   Brassica oleracea (wild cabbage): 106317834Help
Entry
106317834         CDS       T04124                                 

Definition
(RefSeq) nucleoside diphosphate kinase II, chloroplastic
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00230  Purine metabolism
boe00240  Pyrimidine metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe04016  MAPK signaling pathway - plant
Module
boe_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
boe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
boe_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106317834
   00240 Pyrimidine metabolism
    106317834
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    106317834
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:boe04131]
    106317834
Enzymes [BR:boe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     106317834
Membrane trafficking [BR:boe04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    106317834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 106317834
NCBI-ProteinID: XP_013611065
UniProt: A0A0D3E209
Position
C9
AA seq 229 aa AA seqDB search
MAGVGQWTLCVASPSPRLTPAICSSNSSPTTVNFRAELAAFRPQFRLFSRTSPSRRRLRA
SSSEESGGIFLPHLVASMEQVEETYIMVKPDGIQRGLVGEIISRFENKGFKLIGLKMFQC
PRELAEEHYKDLSSKSFFPSLIEYITSGPVVCMAWEGVGVVASARKMIGKTDPLQAEPGT
IRGDLAVQTGRNIVHGSDSPENGKREIALWFKEGELCEWDLVLAKWLRE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctggggttggtcaatggactctctgcgtcgcttcgccgtcgccgagactaactccg
gcgatttgcagttcaaactcttctccaaccactgttaacttccgcgctgagctggcagca
ttccgtcctcagttccgtctattctctcgtacgtctccgtcccgtcgccgtcttcgcgct
tccagctccgaggagtcaggaggaatcttccttcctcaccttgttgcttccatggagcaa
gttgaggagacttacatcatggtgaaaccagacggcatacaacgaggccttgttggagaa
atcatctctcgttttgagaataaggggtttaaactcattggacttaagatgttccagtgc
cctagagagttagctgaggaacattataaggatcttagctctaagtcattcttccctagc
ctcattgagtacatcacttcaggccctgttgtgtgtatggcttgggaaggtgttggtgta
gttgcttcagcaaggaagatgattgggaaaacagatcctcttcaagctgaacctggcact
attagaggagatctcgctgtacaaactggaaggaacattgtgcatggtagtgatagtcct
gaaaacggaaagcgtgagattgctctgtggttcaaagaaggcgagctatgcgagtgggat
ttggttctagctaaatggctaagggaatga

DBGET integrated database retrieval system