KEGG   Brassica oleracea (wild cabbage): 106318636Help
Entry
106318636         CDS       T04124                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 2, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00071  Fatty acid degradation
boe00592  alpha-Linolenic acid metabolism
boe01040  Biosynthesis of unsaturated fatty acids
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01212  Fatty acid metabolism
boe04146  Peroxisome
Module
boe_M00087  beta-Oxidation
boe_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106318636
   00592 alpha-Linolenic acid metabolism
    106318636
   01040 Biosynthesis of unsaturated fatty acids
    106318636
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106318636
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     106318636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 106318636
NCBI-ProteinID: XP_013612150
UniProt: A0A0D3E2A1
Position
C9
AA seq 680 aa AA seqDB search
MALEELSEIAAARRIQRLSSHISPALTEPPQLQTEACSSRSRKLVVNGQALSLYMKGKHR
DIQEKVHEFYNSRPDLQTPLEISKDDHRELCMRQLYALVREAGIRPFRYVADDPAKYFAI
MEAVGGVDMSFGIKMGVQYSLWGGSVINLGTKKHRDKYFDGIDNLDYLGCFAMTELHHGS
NVQGLQTTATFDPITDEFIIDTPHDGAIKWWIGNAAVHGKLATVFARLILPTHDTKGVSD
MGVHAFIVPIRDMKTHQTLPGVEIQDCGQKVGLNGVDNGALRFRSVRIPRDNLLNRFGDV
SRDGKYTSSLPTINKRFGATLGELVGGRVALAYSSVGVLKVSATIAIRYSLLRQQFGPPK
QPEVSILDYQSQQHKLMPMLASTYAYHFATVYLVEKYSEMKKTNDEQLVADVHALSAGLK
SYITSYTAKALSVCREACGGHGYAAVNRFGGLRNDHDIFQTFEGDNTVLLQQVAADLLKR
YKEKFQGGTLTVTWSYLRESMSSYLAQPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQ
SVAMRLKKHSKTLGTFGAWNRCLNHLLTLAESHIETVILAKFIEAVRKCPDPSARAGLKL
VCDLYALDRIWNDIGTYRNVDYVAPNKAKAIHKLAEYLSFQVRNVAKELVDAFELPDHVT
RAPIAMQADAYAQYTQVVGF
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggaagagttatccgagatagctgcggcgaggaggattcagagactatcgtca
catatatctcccgccttaacggagccgccgcagctgcagacggaggcgtgctcttcgcgg
tcgaggaagctggtggtcaacggtcaggcgttgtctctctacatgaaggggaaacacagg
gatattcaggagaaagtgcacgagttctacaactctcgtcccgatttgcagacgccgctc
gagatctccaaggacgatcatagggagttgtgtatgaggcagctatatgcgcttgttaga
gaagcaggtataaggccgtttaggtatgtggctgatgatccggcgaagtattttgcgatc
atggaagctgttgggggtgtggatatgtcgtttgggatcaagatgggtgttcagtacagt
ctttggggaggctctgtaatcaacttgggaacaaagaagcatagagacaagtatttcgac
ggcattgacaatctagactacctcggttgctttgctatgactgaactccaccatggttca
aatgttcaaggtctccagaccacggccactttcgaccccatcacagacgagttcataatc
gacacaccacacgatggagccatcaaatggtggataggaaacgccgcagtccacggaaag
ctcgccacagttttcgccaggctcatccttccaacacatgacaccaaaggagtctccgac
atgggcgttcacgccttcatagtccccataagagacatgaaaacacaccagaccctccca
ggcgtcgagattcaagactgcggacagaaagtaggtctgaacggagtcgacaacggtgct
ttaaggttccgttccgtgagaatcccacgtgacaaccttctcaaccgcttcggagatgtg
tcacgagacggcaagtatacaagcagcttaccaacgatcaacaaaagatttggtgcaaca
ctcggtgagcttgtaggtggacgagtggctcttgcttattcatccgttggtgtactcaaa
gtctcggccactattgctatacgttactcgttgttaagacaacagtttggtcctccgaag
cagcctgaggttagtatccttgattaccagtctcaacaacacaagctaatgcccatgttg
gcttccacctatgcgtaccatttcgcaaccgtgtacctcgtggagaaatattcagagatg
aagaagactaacgatgagcagttagttgctgatgtccacgcgctatctgctggtctcaaa
tcttatataacgtcgtacacggctaaggcgctttcggtatgtagagaagcttgtggagga
catggttatgcagctgttaacaggtttggaggcttgaggaatgatcatgatatatttcaa
acgtttgaaggagacaacacagtgcttctacaacaggtggcagctgatttgctgaagaga
tacaaagagaagttccaaggtgggacattgacagtcacatggagttacttgagagaatcg
atgagctcttatttggctcagccaaatccagttacagctcgttgggaaggtgaagatcat
ctaagagatcctaagttccaactagatgctttccggtatcgaacatcacgtctcctacaa
agtgtggcaatgcgtttgaagaaacacagcaagacacttggaacattcggtgcatggaac
aggtgcttgaatcatctcttgacactagctgaatctcacattgaaacagtcattctcgcc
aagttcatcgaagctgttagaaagtgtccggacccaagtgcaagagctggtctgaaacta
gtatgtgatctttacgcattggaccgaatatggaatgatataggaacgtaccgtaacgtg
gactatgtggcgcctaacaaagccaaggcgattcataagttggccgagtatttgagtttc
caagtaaggaacgtggcgaaggagctagtggacgcgtttgagttgccggatcatgtgact
cgagcgccgattgctatgcaagctgatgcttatgcacagtatactcaagttgttggattc
tga

DBGET integrated database retrieval system