KEGG   Brassica oleracea (wild cabbage): 106320122Help
Entry
106320122         CDS       T04124                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative ATP-dependent RNA helicase DHX33
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106320122
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:boe03041]
    106320122
Enzymes [BR:boe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106320122
Spliceosome [BR:boe03041]
 Complex C
  Other components
   Step II factors
    106320122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 AAA_30 DEAD AAA_19 T2SSE PhoH ABC_tran AAA_23 AAA_16 FtsK_SpoIIIE AAA_29
Motif
Other DBs
NCBI-GeneID: 106320122
NCBI-ProteinID: XP_013613944
Position
Unknown
AA seq 690 aa AA seqDB search
MAQGELKSSVLNRKRNPKSPVASRSSKRQKIAEHRKSLPIASEEEHLIKAVQKNDILIIV
GETGSGKTTQLPQFLFNAGFCREGKMVGITQPRRIAALTIAKRVAEECDVPLGQKVGYAV
RFDDTTSSSTRLKYMTDGFLLREALVDRLLSRYSVIIIDEAHERTVHTDVLLALLKKVQR
ERSEIGGGVLRGCQGRKVSPLKLIIMSASLDARVFCDYYGGAKDFHVEGRQFDVDIFYTV
HPETDYVDAALNTIFQIHSEEEEGDILVFLTGQEEIESVERLVQEKLQHLPEDERKLLPL
AIFSALPSEQQMRVFAPAPIGSRKVVLATNIAETSITIPGIRYVVDSGVVKARTYDPNKG
METLDVVPVSKAQAIQRSGRAGREGYGKSFHLYPERDFWKLEDSTKPEIKRCNLSNVILQ
LKALGIDDIVGFDFIDKPSRSAIVKALAELHLLGALTDDCKLAKPAGEQMARLPLKPVYS
RALILANQFNCLEEMLITVAMLSVESIYIYDRREKREEARTSRNHFVSVEGDHLTYLSVY
RELDEFLEERKAENSEAKAEKNMRKWCKDNFVNSRSLKHARDIYRQIRGNVEQMGFNVSS
CGDDMLEYRKCLAASFFLKAAQRQMDGTYRALESGEIVHIHPSSVLFRSKPECVIFDELM
QTSQKYINNLTRIDPLWLAESAXHHYKTDE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaggagaactcaagagctctgtgctaaacagaaaacgaaaccctaaatcaccc
gttgcttctcgctcaagcaagaggcagaagatagcagaacatagaaagtctcttcctata
gcttcagaggaggaacatcttattaaggcggttcaaaagaatgatattctgattattgtt
ggtgaaaccggtagtgggaagactactcagctgcctcagttcctgttcaatgctggtttc
tgtcgggaaggaaagatggtagggataacacagccgaggcgtatcgctgccttgaccatt
gccaaaagggtagctgaggagtgtgatgttccgttaggacaaaaggttggctacgccgtt
aggtttgatgatactacttccagctccacgaggttaaaatacatgactgatggtttcttg
ctgagagaggccttggtggatcggcttctttctagatattcagtcattattatcgatgaa
gctcatgagaggactgtccacacggatgttctcctggccttgcttaaaaaggtgcaacgg
gagagaagtgagattggtggtggtgtgttgagagggtgtcaaggcagaaaagtatctccg
ttaaagctgataatcatgtccgcgagtttagacgcacgtgttttctgtgactactacggc
ggtgccaaagattttcatgtggaagggagacagtttgatgtggacattttttacactgtt
catcccgagactgattatgtagatgcagctttgaatactatatttcagattcattcagag
gaggaggaaggtgatatacttgttttcctcactggacaagaggagattgaatctgttgag
agactagtccaagaaaaacttcagcatttacctgaagacgagaggaagctgcttccactt
gctatattctctgctcttccgtcagagcagcagatgagagttttcgcccctgcgcctatt
ggttcccgtaaggtggttttggccacaaatatagcggagacatcgattacaattcctgga
ataagatatgtggtagactctggggttgttaaggcacgaacctatgatccgaacaaagga
atggagacgcttgatgttgttccagtatcaaaagcacaggccattcaaagaagtgggcgc
gcaggacgtgagggttatgggaaaagtttccatctttatcctgagagagatttttggaaa
ctggaggattcaaccaaaccagagatcaagagatgcaatctctctaatgttattttgcag
ctcaaggctctggggattgatgatattgttggatttgattttattgataaaccttcaagg
agcgccattgtaaaagcattggcggagttgcacttgcttggtgccttgactgacgattgc
aaactagcaaaacccgctggggaacaaatggcacggctcccactaaagcctgtttactcc
agagctctgattttagctaatcagttcaactgtcttgaggaaatgttaatcactgtcgca
atgctttctgtggaatccatatatatatatgatcgtcgtgagaagagagaagaggcaaga
acttcaagaaaccactttgttagcgttgaaggggatcatctaacttatctcagtgtctat
cgagagttggatgagttcttggaggagagaaaggcggaaaacagtgaagccaaagctgag
aaaaatatgagaaagtggtgtaaggacaacttcgtgaatagtcgttccttgaaacatgct
cgtgacatttatagacaaattcgtggaaacgttgaacagatggggtttaatgtgtcttct
tgcggagatgacatgcttgagtaccgtaaatgtcttgctgcgtcgtttttccttaaagca
gcacagagacagatggatggtacatacagggctttggaaagtggtgagattgtgcacatc
cacccaagttctgttttattccgttccaaacctgagtgtgttatcttcgacgagcttatg
caaaccagccagaagtacatcaacaacctgacaagaattgatcccttatggttggctgag
tcggctnctcatcattacaaaacagatgagtga

DBGET integrated database retrieval system