KEGG   Brassica oleracea (wild cabbage): 106320612Help
Entry
106320612         CDS       T04124                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03013  RNA transport
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106320612
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:boe03012]
    106320612
Translation factors [BR:boe03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    106320612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI UPF0149
Motif
Other DBs
NCBI-GeneID: 106320612
NCBI-ProteinID: XP_013614443
UniProt: A0A0D2ZSR3
Position
Unknown
AA seq 891 aa AA seqDB search
MTSRFFAQGATDSEDESDYEEEITEVQNNIDSRYLDGGSDDDDDTDTKRVVKPAKDKRFE
EMTHTVEQMKNAMKINDWVSLQENFDKVNKQLEKVMRITEAVKAPILYIKTLVLLEDFLN
EALANKEAKKKMSPSNSKALNAMRQKLKKNNKLYEEDIVKYREAPEVEDDNEGEDDDEED
SEFEDDVSIEDVTVEPVDEPVDDNRWETMKNKGEREMEKLLSKDPKEITWEWVNQKFKEI
VASRGKKGTARFELVDQLTHLTKIAKTPAQKLEILFSVISAQFDVNPGLSGHMPIKVWKK
CVLNMLTILDILVKYNNIVVDDTIEPDENESSKPADYDGKIRVWGNLVAFIERIDTEFFK
SLQSIDPHTREYVERLRDEPMFLALAQNIQDYFERMGDFKAAAKVALRRVESIYYKPQEV
YEAMRKLAELAEEDDENEEDEEENGPPSSFIVVPEVVPRKPTFPESGRAMMDLLVSLIYR
NGDERTKARAMLCDIYHHALMDNFGTARDLLLMSHLQDNIQHMDISTQILFNRTMAQLGL
CAFRVGMISESHSCLSELYSGQRVRELLAQGVSQSRYHEKTPEQERMERRRQMPYHMHLN
LELLEAVHLIGAMLLEVPNMAANSLEARRRVISKNFRRLLEISERQAFNAPPENVRDHVM
AATRALTKGDFQTAFEVLNSLDVWRLLKNRDSILEMVKARIKEEALRTYLFTYSSSYESL
SLDQLAKMFDLSKALVHSIVSKMMINEELHASWDQPTQCIVFHEVQHSRLQSLAFQLTEK
LSVLAESNERAMEARTGGGGLDLSSRRRDNNQDYAGAASGGGKWQDNMNSGYGGRQGNNR
SGYGGRPGQPRDWSGQNRGGAYAGRAGSGNRGGMQMDGSSRMVNLNRGGRP
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacgttttttcgctcagggtgctactgatagcgaagatgagagtgattacgag
gaagagatcacggaggttcagaacaacatcgatagccgttacctcgacggtggcagcgac
gatgacgacgacacggataccaagcgtgtcgtcaagccggcgaaggataagcgtttcgag
gagatgacgcacaccgttgagcagatgaagaacgctatgaagatcaatgattgggtcagc
ctccaggagaattttgataaagtcaacaaacagcttgagaaagttatgaggatcactgag
gctgtgaaagctccgatcttgtatatcaagacgcttgtgttgctggaggatttcttgaat
gaggctttggctaataaggaagcgaagaagaagatgagtcctagcaattccaaggcgttg
aacgctatgaggcagaagctgaagaagaataataagctgtatgaagaggatatcgttaag
tacagggaggctccagaagttgaggatgacaacgaaggagaagatgatgacgaagaggat
tctgagtttgaggatgatgtttccatagaggatgtgactgtagagccagtggacgaacct
gttgatgataatcgctgggagacgatgaagaacaagggagaaagggaaatggagaagctg
cttagcaaagatcctaaagagatcacttgggagtgggtcaaccagaagttcaaagagatt
gttgcttctcgtgggaagaaggggactgctcgattcgagcttgttgatcagcttacacac
ttgacaaagattgccaagactcctgcgcagaagctcgaaatccttttcagcgttatctca
gcacagtttgatgtgaatccgggtctcagcggacacatgcccatcaaagtctggaagaaa
tgcgtgctcaacatgctcaccatacttgacattcttgtcaagtacaataacattgttgtg
gacgacacgattgagcctgatgagaatgaatcttcaaagccagcagactatgatggaaag
attcgggtctggggaaacttggttgcgttcattgagaggattgacactgagttttttaag
agtttgcagtccattgatcctcacacccgtgagtacgttgagaggctgagggatgagccc
atgttcttggcccttgctcagaacatccaggactactttgagcggatgggtgattttaaa
gctgctgcaaaggtggccttgagacgtgttgagtcaatatattacaagccccaggaagtt
tatgaagctatgaggaaattggctgagttggctgaagaagatgatgaaaatgaggaggac
gaagaggaaaatggacctccttcttcattcattgttgttccagaggttgttccccgtaag
cctaccttcccagagagcggccgagcaatgatggatcttcttgtgtcccttatctacaga
aacggagatgagcggaccaaggcccgtgcaatgctgtgtgatatctaccaccatgctttg
atggacaactttgggactgctagagacttgttgctaatgagtcatctccaagacaacatt
cagcacatggacatctcaacacagattctctttaacaggaccatggcgcagcttggtctt
tgtgccttcagggttggaatgatctctgaatcccatagctgcctctctgagctgtactct
ggtcaaagagtgagggagttacttgcccaaggtgtctcgcaaagtcggtatcatgagaag
acacccgaacaggaaaggatggagaggagaagacaaatgccataccacatgcacttaaac
ctcgagctccttgaggctgttcatctcattggtgccatgctacttgaagtcccaaacatg
gcagcaaactcgcttgaagccagacgcagagtgattagcaagaacttccgtcgcctgctc
gagatcagtgagaggcaagcgttcaatgcaccaccagagaatgtgcgtgatcacgtcatg
gcggccaccagagccttgaccaaaggagatttccagacggcgtttgaagttttgaactcc
cttgatgtctggagactgctgaagaaccgggacagcatcctcgaaatggtgaaagctagg
atcaaagaagaggctctaaggacttacctgttcacatactcgagctcctatgagtcactt
agccttgaccagctggctaagatgtttgatctctccaaagctctggttcacagcattgtg
agcaaaatgatgatcaacgaagagcttcatgcaagctgggaccagcccacacaatgcatc
gtcttccatgaagtgcaacacagcagattacagtcattggcttttcagttaaccgagaaa
ctctcggttttggcagaaagtaacgaaagggcaatggaagctagaaccggtggaggtggt
cttgatctgagttcaaggagaagggacaacaatcaggactatgcaggcgcagcatcaggt
ggtgggaaatggcaggacaacatgaattctggatatggaggaagacaaggtaacaacaga
tctggatatggaggaaggccaggacagcctagagactggtcgggccagaaccgaggagga
gcatatgcaggaagagctggctcaggaaacagaggtggtatgcaaatggatggctcaagt
cgtatggtgaatcttaacagaggtggtcgcccttaa

DBGET integrated database retrieval system