KEGG   Brassica oleracea (wild cabbage): 106321236Help
Entry
106321236         CDS       T04124                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00450  Selenocompound metabolism
boe00970  Aminoacyl-tRNA biosynthesis
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106321236
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106321236
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:boe01007]
    106321236
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:boe03016]
    106321236
Enzymes [BR:boe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106321236
Amino acid related enzymes [BR:boe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106321236
Transfer RNA biogenesis [BR:boe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106321236
 Prokaryotic type
   Other AARSs
    106321236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_bind tRNA-synt_1g Anticodon_1
Motif
Other DBs
NCBI-GeneID: 106321236
NCBI-ProteinID: XP_013615001
Position
Unknown
AA seq 492 aa AA seqDB search
MGKDNVPFHTVMFPSTQLGTAENWTLMKTISVTEYLNYQDGKFSKSKGVGVFGNDVKSTN
IPVEVWRYYLLANRPEVSDTLFTWKDLQAKLTGELLNNLGNFVNRVLTFIAKPEPAGYGS
VIPDALGAESHPLTQSLAENVGKFVEQYVEAMEKVKLKQGLKIAMSISNEGNAYLQEAKF
WKLYKEDKPSCAIVIRTAAGLVHLLAQLLEPFMPSFSREVFKQLNLPLQFSLSDEGGEVL
LASRPWEILPRNHKIGTPQPLFKELTDEEVQQYKDKFAGNQADRRARDAEAANMAADQLK
KTKLSNAKKQKAXKGAATSKTQPAADRELTLARLDIRVGKILKAEKHPNADSLYVEEIDV
GGAETRTIVSGLVKYIPLEEMQNRMVCVLCNLKPAKMRDVMSQGMVLAASSSDGSKVELV
EPPESAEIGERVRFQGFEGEPDVVLNPTKKVWETLVVDLHTDENLVACYKDLPFTTDAGV
CKVSSISNGTIR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagacaacgtgccttttcacactgtgatgtttccatctacgcagcttggaact
gcggagaattggacactgatgaagacaatcagtgtgactgaatatttaaattaccaagat
ggaaagttctccaagagtaaaggtgttggagtgtttggtaatgatgtaaaaagtacaaat
atccctgtcgaagtatggagatattacttgctggcgaacaggcctgaggtgtccgacaca
ctatttacatggaaagatttgcaagcaaaactgactggcgagttactgaataacctaggc
aactttgttaacagagttctgacttttatagcaaagcctgaacctgcaggttatgggtct
gtcattcctgatgctcttggtgctgaatctcatcctttaacgcaatctctggctgaaaat
gttggaaaatttgtggagcagtatgttgaagccatggaaaaggttaagctcaagcagggt
ctgaaaattgctatgagcatctcgaatgaagggaacgcatacttgcaggaagccaaattt
tggaaactttacaaggaagataaaccttcttgtgcaattgttataagaactgctgctggt
ttagttcatcttcttgcacaattgttagaacctttcatgccatcattttctcgtgaggta
tttaaacagctaaatttgccactacaattttcactctctgacgagggaggagaggtttta
ttagcaagtagaccgtgggagattctgcctcgcaatcacaagataggcacccctcaacca
ttgttcaaggaattgacagatgaagaagtgcaacagtacaaagacaagtttgctggaaat
caggctgatagacgtgctagggatgcagaagccgcaaatatggcggcggatcaacttaag
aaaacaaaactttcaaatgctaaaaagcaaaaagcatgaaaaggtgcagcaacatccaaa
actcaaccggctgctgatcgtgaacttacactggcaagacttgatattcgagtcggtaaa
attctcaaggctgagaaacatcctaacgcagattcgctgtatgtggaagaaattgatgtt
ggaggagctgaaactcggactattgttagtggattggtcaagtacatacctcttgaggag
atgcagaaccgtatggtttgtgttctttgcaacttgaaaccggcgaaaatgagggatgtt
atgtcacaaggaatggttcttgccgcttccagtagtgacggcagcaaggtggagttagtc
gagccccctgaatcggctgagattggagagcgagttagatttcaagggtttgaaggcgag
ccagacgttgtcttaaatccgacgaagaaagtatgggagactcttgtggtggatctgcac
acagatgagaatctagttgcttgctacaaagatttacccttcactacagatgcaggtgta
tgcaaggtttcctccatcagcaatggcacgatccggtag

DBGET integrated database retrieval system