KEGG   Brassica oleracea (wild cabbage): 106322045Help
Entry
106322045         CDS       T04124                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 1A, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00630  Glyoxylate and dicarboxylate metabolism
boe00710  Carbon fixation in photosynthetic organisms
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106322045
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106322045
Enzymes [BR:boe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     106322045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RbcS RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 106322045
NCBI-ProteinID: XP_013615687
UniProt: A0A0D2ZXG6
Position
Unknown
AA seq 108 aa AA seqDB search
MASVRLSSATMTSSLAHATMVAPFIRLKSSAAFPVTCKANTEITSITSNGGRINCMKVWP
PVGKKKFETLSYLPGLTDVEIAKEIDYLIRNKWTPCIEFEVEVRKTEK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgttaggctctcttccgctacaatgacctcttctctggctcatgccacaatg
gtcgcaccattcatcagacttaagtcctctgctgcattcccagtgacatgtaaggccaac
accgaaattacttccatcacaagcaacggcggaagaattaactgcatgaaggtgtggcct
cctgttggcaagaagaagtttgagactctctcttaccttcctggccttaccgatgtcgaa
atagccaaggaaattgactaccttatccgcaacaagtggactccatgtattgaattcgag
gtggaggtaagaaaaactgaaaaatga

DBGET integrated database retrieval system