KEGG   Brassica oleracea (wild cabbage): 106324302Help
Entry
106324302         CDS       T04124                                 

Definition
(RefSeq) glutathione S-transferase Z1-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00350  Tyrosine metabolism
boe01100  Metabolic pathways
Module
boe_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106324302
Enzymes [BR:boe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     106324302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 Glutaredoxin AMPKBI
Motif
Other DBs
NCBI-GeneID: 106324302
NCBI-ProteinID: XP_013617750
Position
C2
AA seq 226 aa AA seqDB search
MKAKLKLYSYWRSSRGHRVRIALSLKGIEYEYIPVNLLKGEQFDPDFMKINPMGTVPALV
DGEVVITDSFAIIMYLDEKYPEPPLLPRDLHKRALNHQVASIISSGIQPHQNLADDMKLI
ITSLLKLLSLGTSRKRKIAWVNNAIRKGYTALEKLLVNCAGKYATGDEIYLADLFLVAQV
HGAMIKFKIDVEPYPTLAKCYESYKELSVFEDAVAAKQPDAPALMI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaagcttaagctatactcttactggagaagctctcgtggccatcgtgtgcgt
atagccctcagtttaaaagggattgaatatgaatatataccagtgaacttgctcaaggga
gagcagtttgacccagatttcatgaagatcaatccaatgggtactgtgcctgcgcttgtt
gatggagaggttgtgattactgattcttttgccattattatgtatctagatgagaagtat
cctgaaccaccgttgttacctcgtgacctccataaacgagctctaaatcaccaggttgcg
agtattatctcctctggtatacagccacatcagaatctagccgatgacatgaaactgatt
ataacttcacttcttaaactcttatcattaggtacatcgaggaaaaggaagattgcttgg
gttaataacgctatcagaaaaggatatacagctctggagaagctcttggtgaattgcgct
ggaaaatatgcaactggtgatgagatttacctggctgatctttttctagtagcccaagtc
catggagctatgatcaaattcaagatcgatgtggaaccgtacccgactcttgcaaagtgt
tatgagtcatacaaggaactgtctgtgtttgaagatgcagtcgcagccaagcagccagat
gctccagctctaatgatttga

DBGET integrated database retrieval system