KEGG   Brassica oleracea (wild cabbage): 106327035Help
Entry
106327035         CDS       T04124                                 

Definition
(RefSeq) methionine S-methyltransferase
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00450  Selenocompound metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106327035
Enzymes [BR:boe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     106327035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 MTS PrmA Methyltransf_31 Methyltransf_25 Methyltransf_12 Met_10 Methyltransf_11 DUF4726 Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 106327035
NCBI-ProteinID: XP_013620487
UniProt: A0A0D3AN38
Position
C2
AA seq 1063 aa AA seqDB search
MAGESVDEFLNRCQQSGDAAYGALRSVLERLEDPNTRSSARIFLSDLYKRVGSSDTCLQT
YHFHIQDIVLDQYEGFQSRKKLTMMVIPSIFVPEDWSFTFYEGLNRHPDTVFKDKTISEL
GCGNGWISIAIAAKWLPTKVYGLDINPRAVKISWINLYLNALDDNGLPVYDDEKKTLLDR
VEFYESDLLSYCRDNKIQLERIVGCIPQILNPNPEAMSKMIEENASEEFLHSLSNYCALQ
GFVEDQFGLGLIARAVEEGISVIKPAGIMIFNMGGRPGQGVCRRLFERRGVRVTQIWQTK
ILQAADTDISALVEIERSSPHRFEFFMGLSGDQPICARTAWAYGKAGGRISHALSVYSCQ
LRQPNQVKKIFDFLKNGFQEISSSLDLSFEDEAVADEKIPFLAYLASVLKNSSYFPFEPP
AGSKRFCSLIAGFMRTYHRIPINQDNIVVFPSRAVAIESAFRLFSPRLAIVDEHLTRQLP
RTWLTSLAIEDTSMEASGDQVTVIESPHQSDLMIELIKKLKPQVVVTGLAQFEVITSSSF
LHLLDVTKEIGCRLFLDISDHFELSSLPASNGVLKYLAENQLPSHAAIICGLVKNKVYSD
LEVAFVISEVDGISKALSKTVEVLEGHTAIISQYYYGCLFHELLAFQLADRHAPAERGIE
KAKSEEIIGFSSSAASVLKDSELSVTENGDTSLIHMDVDQSFLPIPRSVKAAIFESFVRQ
NVSEAEVDVNPSIKQFVTNSYGFPTKSSTGFVYADGSQALFNKLVVCCAQEGGTLCLPAG
TNGKYVAAAKFLKANVVNIPTESSDGFKLTKITLTKALESVKKPWVYISGPTVSPTGLVY
SNEEMGVLLSTCARFGAKVIIDTSFSGLEYSSTTWDLKKSLDASLSVSLLGCLSLNMLSG
AMKLGFLVLDQSLVDAFHTLPGLSKPHSTVKYAAKKMLALKEEKASDFLDAVSETIKTLQ
GRSKRLKEVLEKSGWEVIEPAGGISMVAKPKAYLNKIVKVKEGEVELKDSNMRDVFLSHT
GVCLNSGSWTGIPGYCRFAFALEDSEFEKAIESIAQFKSVLGN
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgaatctgtagacgagttcctgaatcggtgccaacaatcgggcgacgcggct
tatggagccttgcgatcggtgctggaacgtctcgaggatccgaatactcgatccagcgct
cggatcttcttgtcggacctttacaaacgcgtcggatcctcggatacatgtctccagacg
taccacttccatatccaggacatagtcctcgatcaatacgaaggttttcagtcaaggaag
aagttaacgatgatggtgattcctagtatctttgtcccagaagactggtcgttcacgttt
tatgaaggacttaatagacatcctgacaccgtcttcaaggacaagactatttctgaactc
ggctgcgggaatggatggatatccatagccattgctgccaaatggttgcctacaaaggtg
tacgggcttgatattaatcctagagctgtgaaaatttcttggataaatttgtacctcaac
gctcttgatgacaatggcctaccagtctatgatgacgagaagaaaactttactcgacagg
gtggaattctatgaatctgatttgcttagttattgtagagataataaaattcagctcgag
agaattgtaggatgcatacctcagattcttaatccaaacccagaagcaatgtctaagatg
attgaagaaaatgcaagtgaagaatttcttcattcgctgagtaactattgtgcccttcag
ggtttcgttgaggatcagtttggtctaggtttgattgccagagcagttgaagaagggata
tctgtcatcaaacctgcagggattatgatatttaacatgggtggtcgccctgggcaaggc
gtctgtagacgcttgtttgagcggcgtggagtccgtgtcacgcagatatggcagactaaa
atacttcaagctgcagatacggatatctcggcattagttgaaattgagaggagcagccct
catcgtttcgagttttttatgggactttctggagaccaaccaatttgtgctcgaactgct
tgggcctacgggaaggctggtggacgaatctcccatgctttatcggtttatagttgccag
cttcgccaaccaaatcaggttaagaaaatctttgatttcttgaaaaatggattccaagaa
atcagcagttcactggatttatcttttgaagatgaagccgttgctgatgagaaaattcca
ttcctagcatatcttgctagtgttttgaaaaacagctcctatttcccgtttgaacctcca
gctggcagcaaaagattctgtagcctaattgcaggatttatgaggacataccaccgtatt
ccaattaatcaagataacattgtggtgtttccatcaagggctgtggcaatcgagagtgca
ttccggttattctcccctcgacttgcaattgttgatgagcatttaactcgacaacttcca
aggacctggctaacttctttggccattgaggatactagcatggaggcatcaggtgatcaa
gtcacagtcatcgaatccccgcaccaatctgatctgatgatagaactaattaagaaacta
aagccacaggtggtggttactggactggcccaatttgaggtcattaccagttcatccttt
ttgcacctgttggatgtgaccaaggaaattggatgtcgacttttcttggatatatctgac
cactttgagctgtctagcctccctgcatccaatggagtacttaaatatctcgctgaaaat
caactaccttctcacgctgcaattatctgtggtctggtaaagaataaggtgtattcagac
ttagaagtagcctttgtcatttcagaagttgatggcatttccaaggcattgtcgaaaact
gtagaagtattggaaggtcatactgctattatcagtcaatactattatggctgccttttc
catgagcttctggcttttcagctcgctgatcgccatgcaccagctgagaggggaattgag
aaggcaaagtctgaagagatcattggattttcaagctcagccgcttctgttctgaaagat
tcggagctttctgtcactgagaatggcgacacttctctaatccacatggatgtggatcaa
agtttcttgccaattccacgttctgttaaggctgcaatctttgaaagttttgtgaggcag
aacgtatctgaagcggaagttgatgtcaacccaagtatcaagcagtttgtgacgaatagt
tatgggtttcctacaaaaagcagcacaggctttgtatatgctgacggctcacaagcacta
ttcaataaactggtcgtttgctgcgctcaagaaggtggaacgctctgtttacctgctggg
acaaatgggaaatacgttgctgctgccaaatttttgaaagctaacgttgtgaatatccct
actgagtctagcgacggctttaagctgacgaaaatcactctaacgaaagcactagagtcc
gtgaagaaaccatgggtttatatatctggaccaacagttagcccaacaggattggtgtac
agcaacgaggagatgggtgtactattgtctacttgtgctagatttggagcaaaggtcatc
atcgatacttcgttctcgggattagaatacagttcaactacctgggatttgaagaaatct
ttggatgcatccttgtcggtttcgctgcttggatgtctctctttgaatatgctcagtgga
gcaatgaaactcgggtttctagttttggatcagtctctggttgatgccttccataccctc
ccagggctgagcaaaccacacagcactgtgaagtatgccgctaagaaaatgttggccctg
aaagaagagaaagcaagtgactttttggatgccgtttctgaaaccattaaaacgttgcaa
ggcagatccaagcgcttgaaagaggtgctagagaagtctggttgggaggttatcgaacca
gcaggcggaatctcaatggtggcaaagccgaaagcttatctcaacaaaattgtaaaggtg
aaagaaggagaagtggagcttaaggattcaaatatgagggacgtgtttctcagccataca
ggtgtttgcttgaacagcggttcctggactggaatcccaggttactgccgcttcgcattt
gcactggaggacagtgagtttgagaaggctattgaatccatcgctcaatttaaaagcgtc
cttggcaattga

DBGET integrated database retrieval system