KEGG   Brassica oleracea (wild cabbage): 106327205Help
Entry
106327205         CDS       T04124                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03013  RNA transport
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106327205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:boe03012]
    106327205
Translation factors [BR:boe03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    106327205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 106327205
NCBI-ProteinID: XP_013620744
UniProt: A0A0D3AT16
Position
C2
AA seq 993 aa AA seqDB search
MANFAKPENALKRADELINVGQKQDALQALHDLITSKRYRAWQKPLEKIMFKYLDLCVDL
KRGRFAKDGLIQYRIVCQQVNVSSLEEVIKHFLHLSTEKAEQARSQADALEEALDVDDLE
ADRKPEDLQLSIVCGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLEALYAMTAH
KAFQFCKQYKRPTEFRRLCEIIRNHLANLNKYRDQRDRPDLSAPESLQLYLDTRFDQLKV
ATELGLWQEAFRSVEDIYGLMCMVKKTPKSSLLMIYYSKLTEIFWISSSHLYHAYAWFKL
FSLQKNFNKNLSQKDLQLIASSVVLAALSVPPFDRSQSASHMELENEKERNLRMANLIGF
NLEPKFEGRDMLSRSALLSELVSRGVLSCASQEVKDLFHVLEHEFHPLYLGSKIQPLLEK
ISKSGGKLSSAPSLPEVQLSQYVPSLEKLATLRLLQQVSKIYQTIRIESLSQLVPFFEFS
VVEKISVDAVKNSFVAMKVDHMKGVVIFGNLGIESDGLKDHLAVFAECLSKVRAMLYPVP
SKASKLGGILPNLADTVEKEHKRLLARKSIIEKRKEDQERQQLEMEREEEQKRLKLQRLT
EEAEQKRLAAELQERRKQRILREIEEKELEEAQALLEDTEKRMKKGKKKTLLDGEKVTKQ
TVMERALTEQLKERQEMEKKLQKLAKTMDYLERAKREEAAPLIEAAYQRRLVEEREFYER
EQQREVELSRERHESDLKEKNRLSRMLEFKETFQGEVISRRQAEFDRIRTEREERISQII
RARKQERDIKRKQMYYLTSEEERIRKLQEEEEARKLEEAEKRKKQEAEHKAKMDEIAEKQ
RQRERELEEKEKKRREEVLKGTDAPPARAAEPAVATAAAPPASGAGKYVPRFKRQTAEAS
GPAAPTPAAEADRWANRGPPPADDHWGSNRGPSQKSDRWTGGRERAGPPPAEGGDRWVPG
PIGSDRPSGGDAWRTGEERRSPFGSSKPRPAQR
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattttgccaaaccggagaacgcattgaagcgcgctgatgagttgatcaatgtt
ggacagaaacaagatgcccttcaggcacttcatgacctcatcacctccaagaggtacaga
gcatggcagaagccacttgagaagatcatgtttaagtatctggatctttgtgttgacttg
aagaggggtcgtttcgctaaggacggattgatccagtaccgcattgtctgccagcaagtc
aatgtcagctccttggaggaggtaatcaagcactttctacatctttctaccgagaaggcc
gagcaggctcgttctcaggctgatgcactcgaggaggcccttgatgtcgatgaccttgaa
gctgacagaaagcctgaagatttgcagctgagtattgtctgtggggagaaggggaaagat
agatctgaccgtgagctggtcaccccctggttcaagtttctgtgggagacttacagaaca
gtgcttgagatattgcgcaacaactcaaagttggaagcactctatgcgatgaccgcacat
aaagcctttcagttctgtaagcagtacaagcgaccaacggagttccgtaggctttgcgaa
attattagaaaccatttggcaaacctgaacaaatacagagaccaaagagacaggcctgac
ttgtcagccccggagagcttgcagctgtacctggacacaagatttgatcagttgaaagtt
gctactgagcttggactttggcaggaagcttttcgttctgttgaagatatatatggatta
atgtgcatggtcaaaaagacgcccaagtcatctttgttgatgatctactattccaaattg
accgagatcttctggatttcttctagccatctgtaccatgcttatgcatggttcaagctg
tttagtcttcagaaaaatttcaacaagaacttaagccaaaaggacttgcagctaatagca
tcatctgttgtcttggcggccttgtctgttccaccgtttgatcgatcccagagtgcatct
cacatggaacttgaaaatgagaaagaacgcaatttgaggatggccaacctcataggattc
aatcttgaacctaaatttgagggcagagatatgctttcaaggtcagctcttctgtcagag
ctggtttcaagaggtgttttgagctgtgcatctcaggaggtcaaagatctcttccatgtt
ttggagcatgagtttcacccactttatcttggctccaagattcagcctttgctcgaaaaa
atttccaaatctggtgggaagctttcgtcagctccttctttacctgaagtgcaactctcc
caatatgttccttctttggagaaactcgctactctgaggctacttcaacaggtgtctaag
atttatcagactataagaattgagagtttatctcagttggtacccttcttcgaattctca
gtggtagagaagatttctgttgatgctgtgaagaacagttttgtggccatgaaagttgat
cacatgaagggtgttgtaatttttggaaatttgggtatcgagtctgatggactgaaggat
catcttgctgtttttgctgagtgtttgagcaaagtaagagctatgctgtatcctgtccca
agtaaagcatcaaagctaggtggcatattaccaaatcttgcggatactgttgagaaggag
cataaaagattgcttgctcggaaatcaatcattgaaaagaggaaggaggatcaagagcgc
cagcaactagaaatggaacgggaagaggaacagaaacggcttaagcttcagaggctaact
gaggaggcagaacaaaagaggcttgcagcagagcttcaggagagaaggaaacaaagaatc
ctcagggagatagaggagaaggaacttgaggaagctcaggcgttgctggaggacacagag
aaacgcatgaaaaagggaaagaagaagacgcttttagatggagagaaggtgacaaagcaa
actgtgatggagagggccttaactgagcagctcaaggaaaggcaggaaatggagaaaaaa
ctccagaaacttgccaaaactatggattatttggaacgagcaaagagagaagaggctgct
ccattgattgaagctgcatatcagcgaagactggttgaggagagagagttttatgaacgc
gagcaacagcgtgaagttgaactcagtagagagcgtcatgagagtgacttgaaggagaag
aacaggttgtccagaatgttggagtttaaggaaacattccaaggggaagtgattagtcgt
cgacaagcagagtttgacagaataaggacggagagagaagagcgcataagccaaatcatt
cgagcaaggaagcaagaaagggacatcaagaggaagcagatgtattatttgacaagtgaa
gaagaaaggataagaaagctgcaggaagaagaggaagctcgcaagcttgaagaagccgag
aaacgcaagaagcaagaagctgaacacaaagcaaagatggatgaaatcgctgaaaagcaa
aggcagagagaaagagagcttgaggagaaagaaaagaagaggcgggaagaggtgttgaag
ggaactgacgcaccacctgctcgcgctgcagagcctgcagttgctactgctgctgcgcca
ccagcatcaggtgctggtaaatatgttcctaggttcaagcgtcagacagctgaggcctca
ggcccagcagcaccaacaccagctgcagaagctgaccgctgggccaaccgtggaccacct
ccagcagatgaccactggggaagcaacagaggaccgtctcagaaatctgacaggtggacc
ggtggcagggaaagagctggacctcctcccgctgaaggaggagaccgctgggtccctggt
cctataggcagtgaccgcccgagtggtggtgatgcttggcgaactggtgaagaacgacgg
tctccgttcggaagctccaagcccagaccagcacagcgttga

DBGET integrated database retrieval system