KEGG   Brassica oleracea (wild cabbage): 106328724Help
Entry
106328724         CDS       T04124                                 

Definition
(RefSeq) putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106328724
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:boe03041]
    106328724
Enzymes [BR:boe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106328724
Spliceosome [BR:boe03041]
 Complex C
  Other components
   Step II factors
    106328724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD DUF2075 AAA_30 AAA_19 ABC_tran Helicase_RecD cobW AAA_33 AAA_16 ATPase_2 T2SSE AAA_14 NB-ARC AAA_23 AAA_29 DAP3 Sigma54_activ_2 AAA_10 FtsK_SpoIIIE Sigma54_activat SRP54 AAA_7 DUF87 PHtD_u1
Motif
Other DBs
NCBI-GeneID: 106328724
NCBI-ProteinID: XP_013622674
UniProt: A0A0D3BII4
Position
C3
AA seq 704 aa AA seqDB search
MANLPILQFEEKIVETVENNPVVVIIGETGSGKSTQLSQILHRHGYTKSGVIAVTQPRRV
AAVSVARRVAQELDVNLGEDVGYAIRFEDRTSSKTRIKYLTDGVLLRESLSNPMLDDYSV
IILDEAHERSLNTDILLGLMKRLVRIRSSNFKVLITSATLDGEKVSRFFSGCPVLNVPGK
LYPVEILYSKERPGSYIESSLKVAIDIHVREPEGDILIFMTGQDDIEKLVSKLEEKVRSL
AEGSCMDAIIYPLHGSLPPEMQVRVFSPPPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSSGMYSLDVTQISKVQANQRAGRAGRTRPGKCYRLYPLAVYRDDLLDATIPE
IQRTSLAGSVLYLKSLDLPDIDILKFDFLDAPSSESLEDALKQLYLIDAIDENGAITNIG
RTMSELPLEPSLSRTLIEANESGCLSQALTVVAMLSAETTLLPGRSKPNEKKRKRDEESN
LPDGSGFGDHIQLLQIFECWDSNNYDIRWCKENDLQVRGMVFVRDVRRQLCQIMQKISKD
RLEVGARGRKSSSREEYRKLRKALCVGNANQVAERMLRHNGFRTLTFKPQLVQVHPASVL
STDQDGMLPNYVVYHELISTTRPFMRNVCSVEMSWVAPIKRKIEKLNVRKLSGGPDNSFK
EPEEKKSTELSTNTNTAETPTVSENVESRIEAARERFLARKGQK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatctcccgatccttcaattcgaagagaagatcgtggaaacagttgagaacaac
ccagtcgtggtcatcatcggagaaaccggttccggaaagagcactcagctctctcagatc
ctccatcgacacggctacactaagtccggcgtcatcgccgtcactcagccccgtcgtgtc
gccgccgtttccgtcgccaggcgagttgcgcaggagcttgatgtaaacctaggagaagac
gttggttacgctatacgtttcgaagatagaacatcgagcaaaacacgcatcaagtacctc
acagatggagttttactccgtgagagcctctccaatccaatgcttgatgattattctgtg
attatattagatgaagctcacgagaggagtttaaacacggatattctgttgggtctaatg
aagcgtttggttagaatccgttcgtctaacttcaaagtccttataacctctgcaacgctt
gacggcgaaaaggtttctcgattcttttcgggatgccctgtgcttaatgtacctgggaag
ttataccctgtggagatattgtacagcaaagagcgtcccggcagttatattgagtcgtct
ctcaaagtagctattgatatacatgttcgtgagccagaaggtgatatcttgatctttatg
actggacaggatgatatagaaaaattagtatcaaagctggaggaaaaagtgagaagctta
gcagagggatcatgtatggatgctattatttatcctcttcatggatctctgccacctgag
atgcaggttcgtgtgtttagtccacctcctccaaactgccggaggtttattgttgctaca
aatattgctgaaacttcccttactgtggacggagttgtgtatgttattgattcggggtat
gtgaagcaaagacaatataacccatcaagtggaatgtactctcttgatgttactcaaatt
agcaaagttcaagctaaccaacgtgctggacgtgctggtagaactagacctgggaaatgt
taccgattataccccttggcagtctacagagatgatctccttgatgcaacgattcctgaa
atacaacgaacttcccttgctggaagtgttctttacttgaaatcgttggatcttcctgat
attgacattctcaagttcgattttcttgacgctccatcatctgagtcattagaagatgca
ttgaagcagttgtatctcattgacgcaattgatgagaatggagcaataacaaatattgga
aggacgatgtcagagcttccactagagccatcattgtcaaggacattgatagaagcaaat
gaaagtggttgcttatctcaagctctaacagtcgttgctatgttgtcagcagagactact
ctacttcctggtaggagtaaaccaaatgaaaagaagagaaagcgtgatgaagaatctaat
cttcctgatggatccggatttggtgaccacattcaactactacagatttttgaatgttgg
gacagtaataattatgatattcgatggtgcaaagaaaatgacctgcaggtgcgtgggatg
gtgtttgtcagagatgttagacgacaattatgtcagattatgcagaaaatatccaaagat
cgattggaagttggagcacgtgggaggaagagctcaagccgagaggagtacaggaagttg
aggaaagctctatgtgtggggaatgcaaaccaagttgctgagagaatgcttcgtcataat
ggattccgaactcttaccttcaagccccagctagtccaggtgcatccagcatcagtgctg
agtaccgaccaggatggaatgttgccaaattatgtagtgtaccacgaactgatatccacc
acacgaccattcatgcgcaatgtttgttcagttgaaatgtcatgggtggctcccatcaaa
agaaagattgagaaattaaatgtcagaaaactgagtggtggacctgataactctttcaag
gaacctgaagagaagaagagcacggagttgtctacgaacaccaacactgcagaaacacct
acagtttctgaaaatgtcgagagtagaattgaagcagccagagaacgctttcttgctcgt
aaaggacagaaataa

DBGET integrated database retrieval system