KEGG   Brassica oleracea (wild cabbage): 106329170Help
Entry
106329170         CDS       T04124                                 

Definition
(RefSeq) arogenate dehydratase 4, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    106329170
Enzymes [BR:boe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     106329170
    4.2.1.91  arogenate dehydratase
     106329170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 106329170
NCBI-ProteinID: XP_013623236
UniProt: A0A0D3BGN1
Position
C3
AA seq 424 aa AA seqDB search
MQAATSWDLKFRSTNLTASTARSTNAMSKRVNFLCGYRSKRFSFRNGVSVSRTDWQSSCA
ILASKVASVEDPGGLADKIAVVNGHKNSSVDLSLVHVETTNGKLSQVQPLTITDLSPAPL
HGSNLRVAYQGVPGAYSEAAAGKAYPNCEAIPCDQFDVAFQAVELWIADRAVLPVENSLG
GSIHRNYDLLLRHRLHIVGEVQIPVHHCLLALPGVRTDCVSRVISHPQALAQTERSLDNL
TPRAAREAFHDTAAAAEYIAANNLHDTAAVASARAAELYNLQILADGIQDDTGNVTRFLM
LAREPIIPRTDRPFKTSIVFAAQEHKGTSVLFKVLSAFAFRNISLTKIESRPHHNRPLRV
VGDGSFGTAKNFEYMFYVDFEASMAETRAQNALSEVQEYTSFLRVLGSYPMDMTPWSMSP
TEDA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgctacgtcgtgggatctcaagttccgatcaacaaatctgacggctagtact
gcacgttccaccaacgcgatgtcaaagcgcgtgaatttcctatgcggttacaggtcgaag
aggttcagcttccgcaacggcgtctccgtgagccgaacagattggcaaagctcatgcgcc
attttagcaagcaaagttgcttccgtagaagatcccggtggtttagctgacaaaatcgcc
gtcgttaatggtcacaagaacagctccgtcgatctcagcctcgttcacgtcgagacaacc
aacggaaaactatcccaggttcaaccgttaacgatcaccgatctatctccggctccgttg
catgggtctaacctccgagtagcttatcaaggagttcccggagcttactcagaggcagcc
gccggaaaagcatatccaaattgcgaagccattccatgcgaccaattcgacgtcgctttt
caggcggtggagctttggattgccgatagagccgttcttcccgtggagaattcactcggt
ggttcaatccaccggaattacgatctcctcctccgtcaccgtctccacatcgtgggcgaa
gttcagattccagtccaccattgtctcctcgcgcttccgggtgtccgaacagactgcgtc
tcgcgagtgatatctcacccacaggcgctggctcagacagaacgatcactcgacaacctc
accccacgcgcggcacgtgaggccttccacgatacggcggctgcagccgagtatatagcc
gcaaataacctccatgacactgcagctgtggcgagcgcacgcgccgctgagctctacaac
ctccagattttagctgacggaatacaagacgacacaggaaacgtcacgcggttcctaatg
ttggcgcgtgaaccaatcataccacgcacagacaggcctttcaaaactagcatcgtcttt
gcggctcaagaacacaaaggaaccagtgtcctcttcaaagtcctctcggccttcgctttc
cgaaacatcagcttgacgaagatcgagtcgcggccgcaccacaaccgccctctcagggtt
gtcggagacgggagcttcgggacggcgaagaattttgagtatatgttctacgttgatttc
gaggcgtccatggcggaaacacgtgcacagaacgcgctttcagaggttcaggagtacacg
tctttcctaagggtgctgggaagttaccccatggatatgacgccatggtccatgtcaccc
accgaagatgcatga

DBGET integrated database retrieval system