KEGG   Brassica oleracea (wild cabbage): 106329643Help
Entry
106329643         CDS       T04124                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00052  Galactose metabolism
boe00500  Starch and sucrose metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106329643
   00500 Starch and sucrose metabolism
    106329643
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106329643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 106329643
NCBI-ProteinID: XP_013623782
Position
C3
AA seq 566 aa AA seqDB search
MAEDGNDENLPVQNQVLNRTSFHFQPQRNWLNDPNAPMYYKGFYHLFYQHNPLSPEFSRS
IIWGHSVSQDMVNWIQLPPALSPSESYDINSCWSGSATILPDGKPVILYTGIDNQERRED
RRQVTVLAVPKDASDPLLREWVKPKQNPVMDPSEDVLHYCFRDPTTAWLGQDGRWRVLIG
AKERDSRRGVALLYHSTDECVQWTRYQEPLLVSQSNEMLECVDFFPVKLTGKEGVDTSVN
NASVRHVLKVSFEEELGGKDCYVIGSYCSETDRFVPDSELTYTRAALRYDDGWFYASKSF
FDSAKNRRINWGWVVETDSREDDIEKGWAGLLALPRQMWLDTSGKRLMQWPIQEINNLRT
RQVSFHNRQLEGGSMFEITGITAAQADVEVTFDLPVLEDNPRIRDSTHVADAVLFNRGNS
LGCVYGPFGLLALASNDLCEQTAIFFKIIRRENGYSVIMGSDENRSSLRDKVHKIPHGTF
LDIDPRHEKISLRCLIDHSIIESYGAGGRNVITSRVYPKLAIGEAAKLYAFNNGKKGVTM
SSLDAWSMRNAQINTNAIIINNSDDN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatggaaacgacgagaatcttccggttcaaaaccaagtgcttaaccggacc
tccttccatttccaacctcagagaaattggctcaacgatccaaacgcgccaatgtattac
aaaggattctaccatttgttctaccagcacaaccctttgtctccggagttcagtaggagc
atcatatggggccactctgtttcacaagacatggtcaactggatccaactcccgccagca
ctttctccctctgagtcctacgacatcaacagctgctggtcaggatccgccacgatcctc
cccgatggcaaacctgtgatcttgtacaccggaatcgacaaccaagagagacgggaagac
agacggcaagtcacagttcttgctgtacctaaagatgcttccgaccctttgcttcgtgag
tgggtaaagccaaagcaaaaccctgtcatggatccatcagaggacgtacttcattactgt
ttccgtgaccctaccactgcatggctaggtcaagatgggagatggagagttctcatagga
gctaaggagagagatagtcgaagaggagtagctcttttgtaccatagtactgatgaatgt
gtgcaatggacaaggtatcaagaacctttacttgtgtcacaatccaacgaaatgttggag
tgcgttgactttttcccggttaagctcacgggaaaagaaggtgtagatacttcggtgaac
aatgctagtgtgaggcatgtgttgaaagttagttttgaggaagaacttggaggcaaagat
tgttatgttattggctcatattgttccgagactgatagatttgtgccggactcagagctc
acttacacacgtgctgctctgagatatgatgatggatggttttacgcctccaagtcgttc
tttgatagtgctaagaataggaggatcaactggggatgggttgtggagactgatagtaga
gaagatgatattgagaaaggatgggctggccttctggctcttcctaggcaaatgtggctg
gacacaagtggaaagaggctgatgcaatggccaatccaagagatcaataatctccggact
agacaagttagcttccataacaggcaactcgaaggcggctcgatgtttgaaatcacaggc
attactgcagcacaagcagacgttgaagtgacttttgacctgcctgttctggaagataac
ccccggatacgggactcaacgcacgttgctgatgcggttttgttcaatcgtggcaactcg
cttggatgtgtttacgggccttttgggttgctagcattagcttccaatgatttatgcgaa
caaactgcgatcttcttcaagattattcgtcgcgaaaatggatattcggttataatgggc
agcgatgagaatagatcttcgttgagagacaaagtacacaaaattccgcatggaacattc
ctagacattgatccaagacatgagaagatctcattaagatgtttgatcgatcactcgatt
atagagagctatggagcaggaggaagaaatgtaataacttctagggtttatcccaaattg
gcaattggtgaagcagctaagctttacgcgtttaataatggaaagaagggtgtgaccatg
tcgtctctggatgcttggagcatgagaaatgcccaaatcaatacaaatgcaataattatc
aataatagtgatgataattaa

DBGET integrated database retrieval system