KEGG   Brassica oleracea (wild cabbage): 106331311Help
Entry
106331311         CDS       T04124                                 

Definition
(RefSeq) transcription elongation factor TFIIS-like
  KO
K03145  transcription elongation factor S-II
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:boe03021]
    106331311
Transcription machinery [BR:boe03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     106331311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 CTNNBL
Motif
Other DBs
NCBI-GeneID: 106331311
NCBI-ProteinID: XP_013625087
Position
C3
AA seq 368 aa AA seqDB search
MESELIALFEAAKKAADAVAVDGVTSSSPEVSQSLDALEKLKTFPVTYNTLVATQVGKKL
RSLAKHPVEEIKSVATDLLETWKRVVIEETTSKAKKTESTNGCKEVKLERKDVNPVPVKV
QKLQRGDSAKSIKVERKEPDSKVKVERKEPDNKVKMDHRGQTTVKDEKVSRETLTSVKPS
DKAPNGAPKLTSMVKCNDPVRDKIRELLVDAMSKVHGESDEYDRARVVGCDPIRVAVSVE
SHMFEKLGRSTGAQKVKYRSIMFNLRDSNNPDLRRRVLTGEVSPEKLITLSGEEMASDKR
KQETNQIKEKFLFDCERGQAPKASTDQFKCGRCGQRKCTYYQMQTRSADEPMTTYVTCVN
CDNHWKFC
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgagttgattgcattgttcgaggcggcgaagaaggcggcagatgcggtggct
gtcgacggtgttacctcctcaagcccggaggtttctcaatctctcgatgcattagagaaa
ctcaagacgtttcctgtcacgtacaacacgctcgtcgcgactcaggtagggaagaagctg
aggtctcttgcaaagcatcctgttgaggaaatcaaaagcgtagctactgatctgcttgag
acatggaagagagttgtcattgaggagacgacatccaaggctaagaagaccgaaagcaca
aacggttgcaaagaggttaagttggagaggaaggatgtgaaccccgtgcctgtgaaagtc
cagaagctccagaggggtgattcagctaagagtatcaaggttgagagaaaggaaccagac
agcaaagtgaaggtagagagaaaggaaccagacaacaaagttaagatggatcatcgtggt
cagactactgtcaaggatgaaaaggtctcaagagaaacgctaacaagtgtgaagccttca
gacaaggcacctaatggtgctccaaagctgacttcaatggtcaaatgcaacgatcccgtg
cgtgacaagatccgtgagctgcttgtggacgccatgtccaaggttcatggagaatccgat
gagtacgacagagcgagagtagttggatgtgatccaatccgcgttgctgtctctgtggag
tctcatatgtttgagaaactgggccggtcaacgggagcgcagaaggtcaagtacagatct
ataatgttcaacctgagggacagtaacaacccagacctgagaaggagagttctcactggg
gaggtgtcaccagagaaactcatcacactgtcgggtgaagagatggcgagcgacaagagg
aaacaagagaccaaccagatcaaagagaagtttctgttcgattgtgaacgtggtcaggca
ccaaaagcaagtactgaccagttcaagtgcgggcggtgtggtcagcgcaaatgtacttac
tatcagatgcagacaaggagtgctgatgagcccatgacgacttatgttacatgtgttaac
tgtgacaaccactggaagttctgttga

DBGET integrated database retrieval system