KEGG   Brassica oleracea (wild cabbage): 106333144Help
Entry
106333144         CDS       T04124                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00052  Galactose metabolism
boe00500  Starch and sucrose metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106333144
   00500 Starch and sucrose metabolism
    106333144
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106333144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 106333144
NCBI-ProteinID: XP_013627072
Position
C3
AA seq 546 aa AA seqDB search
MEAASCDEHGNFQPYRTSFHFQAHNNWLNDPNGPLYYKGFYHLFYQHNPLNPFFGDIMVW
GHSVSQDLVNWIKLEPALSPSVPSDINSCWSGSTTILPDGKPVILYTGSDTNKHQVTVLA
EPKDPSDPLLREWVKPKGNPVMVPPSNVPVDCFRDPTTAWQGHDGKWRALVGAKEKDSNK
GMAILYHTDDFVQWTKFLVPLLESQVTGMWECVDFFPVAVTGKEGLDTSVNNSSVRHVLK
TSYGGNDCYVIGTYSSETDVFSADSEFTNTAEDLRYDYGNLFASKAFFDSAKNRRISWGW
IMERDSNEDDIVKGWAGIMAIPREIWLEKSGKKLMQWPVEEINNLRAKNVSLDSKQLEGG
SILEISGITASQADIEVAFDLPDLENDTEALDSEEVDQATIIDGYSASVKGFYGPFGLLA
LASNDLSEHTAIFFRVNRRGNGYAVLMCSDESKSSLRDNIEKATLGTSLDIDPRHEKISL
RCLIDHSVIESYGGGGRSVITSRVYPKMAIGEEARLYVFNHGTKAVTMSSLEAWSMRKAQ
INSNET
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcctcttgtgatgaacatggaaacttccagccttaccgaacttccttccat
tttcaagctcataataattggctcaacgatccgaacgggccattgtactacaaaggattc
taccatctgttctaccaacacaaccctttgaatccatttttcggtgatattatggtatgg
ggacactctgtttcacaagatttagtcaactggatcaaactagaaccagccctttctccc
tcagttccctctgacatcaacagctgctggtcaggatccaccaccatcctccctgatggc
aaacctgtaattttgtacaccggaagcgacaccaataaacatcaggtcacagttcttgct
gagcctaaggatccttccgaccctttgcttcgtgaatgggtaaaacctaaaggcaatcct
gttatggttccacctagtaacgtcccggttgattgtttccgtgacccaacgacggcgtgg
caagggcatgatgggaagtggagagcgcttgtaggagctaaggagaaagatagtaacaaa
ggaatggcgattttgtaccacactgatgattttgtgcaatggacaaagtttctagtgcct
ttacttgagtcacaagtcaccggaatgtgggagtgtgtggactttttccctgttgcggtc
actggtaaagagggtttagatacttcggtgaataattctagtgtgaggcatgtgttaaag
acaagttatggaggcaatgattgctatgtcattggcacatactcttcagagactgatgta
ttttctgcggattccgagtttactaacacagctgaagatctgagatatgattatggcaat
ctgtttgcgtccaaggctttctttgatagtgctaagaatcgaaggatctcatggggatgg
attatggaaagagatagcaatgaagatgatattgtcaaaggatgggctggaattatggct
attccaagggagatttggttggaaaaaagtggaaagaagctgatgcagtggccagttgaa
gaaatcaacaatcttagagccaaaaatgttagcttggatagcaagcaactcgaaggcggc
tccatccttgagatatctggcattactgcttcacaagccgacatagaagtagcttttgat
ctacctgatctagaaaatgataccgaggctttggattcagaggaagttgatcaagcgact
ataatcgatggttatagcgcatcggttaaaggtttttatggaccttttggattgttagca
ttggctagcaatgatttatcagagcacactgcaatcttctttagagttaatcgtcgtggg
aatggatatgcggttttaatgtgcagcgatgagagcaagtcttccttgagagacaacata
gaaaaagctacccttggaacatccttagacattgatccaagacatgagaagatatcatta
agatgtttgattgatcactcggttatagagagctatgggggaggaggaagaagtgtgata
acatctagggtttatccgaaaatggcaattggtgaagaagctaggctttacgtgttcaat
catggaacaaaggctgtgaccatgtcatctttggaagcttggagcatgagaaaagcccaa
atcaattcaaacgaaacctaa

DBGET integrated database retrieval system