KEGG   Brassica oleracea (wild cabbage): 106333415Help
Entry
106333415         CDS       T04124                                 

Definition
(RefSeq) NAC domain-containing protein 90-like
Organism
boe  Brassica oleracea (wild cabbage)
SSDB OrthologParalogGFIT
Motif
Pfam: NAM
Motif
Other DBs
NCBI-GeneID: 106333415
NCBI-ProteinID: XP_013627314
UniProt: A0A0D3B2A7
Position
C3
AA seq 235 aa AA seqDB search
MEEDLTTGFRFYPTEDELVVFYLRNQLEGRSGDSMHRVIPVLDVFEVEPSHLPDLAGERC
RGDAEQWFFFVPRQEREARGGRPSRTTGSGYWKATGSPGPVFSKDNRMIGVKKTMVFYTG
KAPTGGKTKWKMNEYKALDDRDNVSTIPKLRHEFSLCRVYITSGSSRAFDRRPVGVLQTG
IMLTNDAAVAETSFIVGTSPEISMSGGEHVDLSVDTDMVDGLTEPIWEWEQLNWP
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaccttacaactgggtttcgcttctatcccacggaagacgaactggttgtg
ttctacctacgaaaccagctcgaaggaaggagtggtgactcaatgcaccgtgtcattccc
gttctagatgtctttgaggtcgaacctagtcatcttccagatcttgcgggagagagatgt
cgaggagatgctgagcaatggttcttctttgtgccaagacaagagcgcgaagcaagagga
ggcaggccgagcagaaccactggttctgggtattggaaagcaactggatcacctggtcca
gtcttttccaaggataacagaatgattggagtcaagaaaactatggttttctacaccgga
aaagcaccaacaggaggaaaaacaaaatggaagatgaatgagtacaaagcccttgacgat
agagacaacgtttccacaatccctaagttgagacatgaattcagtttatgtcgtgtctac
ataacatcaggaagctcaagagcttttgatagacgcccagtgggagttcttcagacaggg
ataatgcttacaaatgatgctgcagttgctgagacatcatttattgtgggaacgtcacca
gaaatttccatgtcaggaggagaacatgttgatctctctgtggacacagacatggtggat
ggtttaactgaaccaatctgggaatgggagcagctgaattggccttga

DBGET integrated database retrieval system