KEGG   Brassica oleracea (wild cabbage): 106334422Help
Entry
106334422         CDS       T04124                                 

Definition
(RefSeq) probable glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00480  Glutathione metabolism
boe00590  Arachidonic acid metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106334422
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106334422
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     106334422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 106334422
NCBI-ProteinID: XP_013628158
UniProt: A0A0D3B4F3
Position
C3
AA seq 169 aa AA seqDB search
MAEESPESIYDFAVKDIEGKDVSLSQFKGKTLLIVNVASKCGLTDANYKELNVLYDKYKD
QGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEK
GGLLIDAIKWNFTKFLVSPDGKVSQRYSPRTSPLQFEKDIQSLLGQASS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggaatctccagagtctatctacgacttcgccgttaaggatattgaaggtaaa
gatgtgagtttgagccaattcaaaggcaaaactcttttgattgtaaacgttgcctccaaa
tgtggtctgacggatgcaaactacaaggaactgaatgttctatacgataaatacaaggac
caagggttggagattttagcgtttccgtgcaatcagttcttgggacaagaaccaggaaac
aatgaagagatccaacaaactgtctgcacaaggttcaaagctgagttccccatctttgac
aaggtggatgtgaacgggaagaacacggcgccattatacaaatacttgaaagcagagaaa
ggaggtttgcttattgacgcaatcaaatggaacttcacaaagttcttggtttcacctgac
ggcaaagtctcccagagatattctcctagaacctctcctcttcaattcgagaaagacatt
caatctctgttgggacaggcttcatcttga

DBGET integrated database retrieval system