KEGG   Brassica oleracea (wild cabbage): 106335029Help
Entry
106335029         CDS       T04124                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106335029
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:boe03041]
    106335029
Enzymes [BR:boe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106335029
Spliceosome [BR:boe03041]
 Complex C
  Other components
   Step II factors
    106335029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 AAA T2SSE DUF2075 AAA_14 Sigma54_activ_2 AAA_16 ABC_tran Flavi_DEAD PhoH
Motif
Other DBs
NCBI-GeneID: 106335029
NCBI-ProteinID: XP_013628899
UniProt: A0A0D3BLT1
Position
C3
AA seq 1087 aa AA seqDB search
MNKLKHLSLVSNICNELETHVVAVAPKDLAEYIIDLGRNSETADELDKKLKKDDAELPDY
FVRSLLTLIHGIYPPQPKSEEKRRFKGLAIKDTKDKVKELEREAQREEDRDDRRDRHRHR
GGRSRGDRYRRGRSRGRGGANEPELYQVYKGRVTRVMESGCFVQFDRFRGKEGLVHVSQM
GAESLVKKRDMQVYVKVLSVKEGGAKYSLSMKDVDQNTGRDYSDSARRSNPSFRTKDTKS
GISGIRILEEERPSRRRPLKKKMSSPERWEAKQIIASGALKATDFPDYYDEDGVGMLYQE
EGAEQELEIEMNEEEPAFLQGQTRCSADMSPVKIFRNPQGSLSRAAALQSALTKERRETG
DQQQRTILDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGNTPTFG
QRSKLSIQEQRESLPIYKLKTELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTKG
KIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTLIKYMTDGMLLREIL
IDENLSQYSVIMLDEAHERTINTDVLFGLLKKLLKRRPDLRVIVTSATLDAEKFSGYFFN
CKIFTIPGKTFPVEILYNKQPESDYLGLALTTVLQIHLTEPEGDILLFLTGQEEIDSACQ
SLYERMKNLGKNVPELIILPVYSALPSEMQSRIFDPPPPGTRKVVVATNIAEASLTIDGI
YYVVDPGFAKQNVYNPKQGLDSLVITPISQASATQRAGRAGRTGPGKCYRLYTKSAYRNE
MPPTSIPEIQRINLGMTTLTMKAMGINDLLSFDFMDPPQPQALISAMEQLYSLGALDEEG
LLTKLGRKMAEFPLQPPLSKMLLASVDLGCSDEILTMIAMVQGDNIFYRPREKQAQADQK
KAKFFQPEGDHLTLLTVYEAWKAKNFSGPWCFDNFIQPRSLRRAQDVRKQLLSIMDKYKL
DVVSAGKNFTKIRKAITAGLFFHVARKDPQEGYRTLVENQPVYIHPGSALFQRQPDGVIY
HDLVMTTKEYMREVTVIDPKWLVELAPRFFKVADPTHMSKRKRQERIEPLYARYHEPNSW
RLSKRRA
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactaaagcacctatctctcgtctccaacatctgcaacgagttggaaacgcat
gtagttgctgtagcgccaaaggatttagccgagtacatcatcgatctgggccgcaactcc
gagacggccgatgaactcgataagaagctgaagaaggacgacgcagagcttcctgattat
ttcgtccggtcgctgttaactttaatccacgggatctaccctccgcagcccaaatccgag
gagaaaaggagattcaagggcttagcgattaaggatactaaggataaggtcaaggagctc
gagagggaagctcagagagaggaggatcgagatgatagaagggatcggcatagacatagg
ggaggaagatcacgtggtgataggtataggagggggagatcacgtggtaggggtggtgcg
aacgagcctgagttgtatcaggtttacaaaggtagagtgactagggtgatggagtctggc
tgctttgttcagtttgataggttcagagggaaagaaggtctagttcatgtttctcagatg
ggggctgagagtttggtgaagaagcgggatatgcaagtgtatgtcaaagttttatctgtc
aaagagggtggtgctaagtatagtctttccatgaaggatgttgatcagaacacgggtaga
gactattcagattcagccaggaggagtaatccatcttttagaacaaaggataccaagtct
gggatttcagggatccggattcttgaggaggagcgtccttcacgtaggaggccactgaag
aagaagatgagctcccctgagagatgggaagccaagcagatcattgcttctggtgctctg
aaagccactgactttcctgattattatgatgaggatggagttgggatgctttatcaggag
gaaggtgctgaacaagagctcgagattgagatgaacgaagaagaacctgctttcttacaa
gggcagaccaggtgctctgccgacatgtctcctgtcaagatcttcagaaatccacaaggc
tccttgagtcgtgctgctgcacttcagtctgcgctcaccaaggagaggagagaaacgggg
gatcagcagcaaagaacaattcttgactctatccccaaggatctgaatcgtccttgggaa
gatcctatgcctgaaactggtgaaaggcatcttgcacaggagcttagaggtgttggatta
tctgcttatgacatgcctgagtggaagaaggatgctttcgggaatactccaacttttgga
caaagatcaaagctttctatccaggagcaaagggagagccttcctatatacaagctgaaa
acggagctgatacaggctgtgcatgataatcaagtgttggtggtcattggtgaaactggt
tcaggcaagacgactcaggtgactcagtatcttgccgaagctggttacactaccaaagga
aagattgggtgtacgcagcctcgtagggtcgcagcaatgtctgttgcaaagagagtagct
gaggagtttggttgtcgtttgggagaggaggtagggtatgctattcggtttgaggattgt
actggaccagatacgctgatcaagtacatgactgatggtatgcttcttagggagattctg
attgatgaaaacctctctcagtactctgttataatgcttgatgaagctcatgagcggaca
attaacactgatgtgttgtttggtcttctcaagaagctgttgaaacgcaggcctgacctt
cgtgtgattgtcacatccgccacattagatgcagagaaattctctgggtatttcttcaac
tgcaaaatctttacaattcctggaaaaaccttccctgtagagattctgtataacaaacag
ccagaaagcgattacttgggtttagccctgaccacagttcttcagattcacttgactgag
ccagagggtgacattcttctctttttgacgggacaggaagagattgattctgcatgtcag
tctctgtacgagagaatgaaaaatctaggtaaaaacgttcctgaactcatcatactacct
gtttacagtgcccttcctagtgaaatgcagtctagaatatttgatcctcctcctcctggt
acccggaaagtagttgtagctacaaatattgcagaagcttctttgacaatagatggaata
tattatgttgttgatcctgggtttgcaaagcagaacgtgtataatccaaagcaaggacta
gattcgcttgtcataaccccaatctcacaggcatcggcaacgcagagagctgggcgtgct
ggtcgtactggtcctgggaaatgttaccgtctctacacgaagagcgcataccgtaatgag
atgcctcctacatcaatccctgaaatccagaggattaacctaggaatgacaacccttacc
atgaaagcaatgggtatcaatgacctgttgtcgtttgacttcatggatccaccccaaccg
caagccttgatctctgctatggaacagctgtacagcctgggagctttggatgaggaaggt
ctgttgacgaagctgggtagaaaaatggctgagtttcctctccaaccaccgctctctaag
atgttgctagcgagtgtggatcttgggtgcagcgatgagattttgacgatgattgctatg
gtccagggggacaacatattttatagaccaagagagaagcaagctcaagcagaccagaag
aaggcaaagtttttccagcctgaaggtgatcacttgacattgctaactgtatatgaagct
tggaaggctaagaacttctcagggccatggtgttttgacaacttcatacagccacgatcc
ttacgacgtgctcaagacgtgaggaaacagcttctcagcattatggacaaatataaacta
gacgtggtaagcgcggggaagaacttcacgaagataaggaaagcaatcacagcaggatta
ttcttccatgtagcaagaaaagatccgcaggaaggttacaggacgctagtggagaatcaa
ccggtttacatacacccgggcagtgcattgttccaaagacaaccagatggggtgatatat
catgatcttgtgatgacgaccaaggagtacatgagagaagtgaccgtgattgacccaaag
tggcttgtggagctagctcctaggtttttcaaagtggctgatccaacccatatgagcaag
cgtaagcgccaggaacgcattgagcctctgtatgctcgttatcacgagcctaactcatgg
cgtctcagcaaaagacgtgcttga

DBGET integrated database retrieval system