KEGG   Brassica oleracea (wild cabbage): 106335843Help
Entry
106335843         CDS       T04124                                 

Definition
(RefSeq) probable protein S-acyltransferase 12
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:boe04131]
    106335843
Enzymes [BR:boe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106335843
Membrane trafficking [BR:boe04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    106335843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Pox_F15
Motif
Other DBs
NCBI-GeneID: 106335843
NCBI-ProteinID: XP_013629931
UniProt: A0A0D3B916
Position
C3
AA seq 291 aa AA seqDB search
MNLFRFCSGLKVLGYFMILLVFAVVAVSYYAVVVNTWWPILIESSHGALSALACLIISLF
HFLLVMLLWSYLTVVFTDPGSVPEHFRRELGGGESLEAGTSTDQGAFGSLGYCPKCRNVK
PPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTFLETMLDVVVLLPSFIK
FFSQAMKHSSSPGKLASLVLAFVLNLAFVLSLLCFVIMHLSLLSTNTTSVEVHEKNGDVR
WKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLHSITSLQGLEFPTRSDIDP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttttccggttctgctccggtctgaaagtcctcggctacttcatgatccttctc
gtcttcgccgtcgtcgccgtttcttactacgccgtcgtggttaacacatggtggccgatc
ttaatcgaaagcagccatggagctctctcagctctcgcatgcctaatcatctctctcttc
catttcctgctggtgatgttgttgtggagctacttaactgtggtctttacggatccaggt
tctgttcctgagcacttcagaagagagcttgggggtggtgagagtttggaggctggtact
tccacagatcaaggagcttttggttctttaggttactgtccgaaatgtcggaatgtcaag
ccgcctcgttgccatcactgttctgtctgtcaaagatgtgttctgaagatggatcatcac
tgtgtttggattgtgaactgtgttggagcgcgcaattacaagtttttccttctctttctg
ttgtatacttttctggagacaatgttggatgttgtagtattgcttccaagtttcatcaag
ttcttcagccaagctatgaagcattcatcttctcctgggaagctggcctccctcgttctg
gctttcgttcttaacttagcgttcgttctcagccttctctgtttcgtaatcatgcatctc
tctcttctctcaaccaatactacttcagttgaggttcatgagaaaaacggagatgttaga
tggaagtatgacttgggaaagaagaaaaacttcgagcaggtttttgggaagaagaaagcg
ttttggctcctcccattgtactctaaagatgatctccatagcataacgtcacttcaaggc
cttgagtttccaactcgttctgacatcgatccttga

DBGET integrated database retrieval system