KEGG   Brassica oleracea (wild cabbage): 106337210Help
Entry
106337210         CDS       T04124                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP19-4
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106337210
Enzymes [BR:boe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     106337210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 106337210
NCBI-ProteinID: XP_013631731
UniProt: A0A0D3BTP6
Position
C4
AA seq 201 aa AA seqDB search
MARSTSILFLTLLLFAALALIQAKEDLKEITHKVYFDVEIDGKEAGRVVIGLFGKTVPKT
AENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFAD
ENFKLKHTGPGLLSMANSGEDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAE
GKQSGTPKSKVVIADSGELPL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgagatcaacctctattctcttcctcacgctactccttttcgctgctctggcttta
atccaggcaaaggaagatttgaaggagatcactcacaaagtttacttcgatgtagagatt
gacggcaaagaagctggtcgagttgttattggccttttcggcaagactgttcccaaaact
gcagaaaatttcagagctctttgcactggggagaaaggtgttgggaagagcgggaagcca
ctacactacaaggggagcaagttccatagaatcattcctagttttatgatccagggaggt
gacttcacacacgggaacggtatgggtggagaatccatctacggtcagaagtttgctgat
gagaacttcaagctcaagcataccggaccaggtttgctttcgatggcaaactctggagag
gacacaaacggttcgcagtttttcatcacgacggtgacaacaagctggttagatggaagg
catgtggtgtttgggaaagtggtacagggaatggatgttgtctacaagattgaagctgag
gggaagcaaagtggaactcctaagagcaaagttgttattgcagacagtggagagcttcct
ctctaa

DBGET integrated database retrieval system