KEGG   Brassica oleracea (wild cabbage): 106340343Help
Entry
106340343         CDS       T04124                                 

Definition
(RefSeq) glutathione S-transferase F8, chloroplastic
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00480  Glutathione metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106340343
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:boe02000]
    106340343
Enzymes [BR:boe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106340343
Transporters [BR:boe02000]
 Other transporters
  Pores ion channels [TC:1]
   106340343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 106340343
NCBI-ProteinID: XP_013634680
UniProt: A0A0D3BNJ0
Position
C4
AA seq 216 aa AA seqDB search
MGGGIKVHGLPISTATMRVLATLYEKGLDFEIVPVDMKAGAHKQEPLISLNPFGQIPALL
DGDLTLFESRAITEYIAEEYSDKGEKLLCQGCKKLKATTKVWLQVEGQQFDPIASKLAFE
RVFKGMLGMTTDPAAVEDLEAKLVKVLDIYEARLSKSPFLAGDCFTLADLHHLPIIYYLM
GTDSKKLFESRPKVNEWIKNITARPAWVKVLHLQKQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcggcatcaaagtacacggacttccaatatcaacggccacaatgcgcgttctg
gctactctttacgagaagggcctcgatttcgagatagtccccgtcgacatgaaagccggt
gctcacaagcaggagcctctcatctccctcaaccccttcggtcaaatccctgctctccta
gacggtgatctgacgcttttcgagtcaagagccatcacagagtacatagcggaggagtac
agcgacaaaggcgagaagcttctctgccaaggctgcaagaaactcaaggccaccacaaag
gtctggcttcaagttgaaggtcaacagtttgaccctatcgcctctaagctagccttcgag
cgtgtcttcaaaggcatgcttggcatgaccactgaccctgccgctgtggaagacctcgaa
gctaagttggtgaaggtcttggatatctacgaggccaggctctccaaatcacccttcttg
gctggtgattgcttcactctggctgatcttcaccacctcccaatcatctattacttgatg
ggtaccgactccaagaagctctttgagtctcgccctaaggttaacgagtggatcaagaac
atcactgccaggcctgcttgggttaaggttcttcacctccagaagcagtga

DBGET integrated database retrieval system