KEGG   Brassica oleracea (wild cabbage): 106341725Help
Entry
106341725         CDS       T04124                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP63 isoform X1
  KO
K09566  peptidyl-prolyl isomerase G (cyclophilin G) [EC:5.2.1.8]
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:boe03041]
    106341725
   03110 Chaperones and folding catalysts [BR:boe03110]
    106341725
Enzymes [BR:boe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     106341725
Spliceosome [BR:boe03041]
 Complex C
  Other components
   PPlases
    106341725
Chaperones and folding catalysts [BR:boe03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    106341725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 106341725
NCBI-ProteinID: XP_013635881
UniProt: A0A0D3BW25
Position
C4
AA seq 533 aa AA seqDB search
MLSVDYSHPLAMNSSSKKKNPTVFLDVSIGGDPLERIVIELFAHVVPKTAENFRALCTGE
AGLGKTTGKPLHFKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFELDHEEG
GVLSMANCGPNTNGSQFFILFKRQPHLDGKHVVFGKVVKGMEVVKKMELVGTSDGKPTSN
VKIIDCGQVSQLKAEDAAEKDKGKLKKSSREKRIKRKRRYSSSSDSYSSSSESETDSSSS
SSSDGKRRKRRRSTKRHKGRRGESNIKGRKGKKNARGDRPPQRRNKDSSSDTESSNSDDE
RMGHEKAKKSKKAKDGVPAADSSPAEKKFSGESLLNENELVGNGKATKVDNDSVKSRSMS
PASRRDQNSKRSKGVRKSPNGEPKRIRKGRGFTERYSFARKYRTPSPERSPPRRSFQDRN
TRDRYPSNRSYSERSRFRSPPRRRSPPRYNRRRRSISRSPDGQRRRWRESQSPSHRSPSP
RKRQPISQDLKSRLGPQRSPPVIGGGRTSPAQSLSASPSTSPSGQRGLVSYAD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctatcggtcgattactcacatcccttagcaatgaatagtagtagtaagaagaagaat
cctactgtattcctggatgtctccattggcggggatccccttgaacgtatcgtcattgag
ctttttgctcatgttgtccccaagactgccgagaactttcgtgccctctgcacaggtgag
gcaggccttggaaagaccactgggaagcctctacatttcaaaggatcttctttccatcga
gtcattaaaggattcatggctcaaggtggtgatttttctaatggaaatggcaccggcggg
gagagcatctatggtgggaagtttccagatgagaactttgaactggaccatgaagaaggt
ggagtcctttcgatggcaaattgtggcccaaacaccaacgggtcacagttttttatcctt
ttcaaacgccagccacatctcgatgggaagcatgttgtatttgggaaagtcgtgaaggga
atggaagttgtcaagaaaatggagcttgtagggacgagtgatggtaaaccaaccagcaat
gtcaaaataattgactgtggccaagtgtctcagttaaaagccgaggatgctgctgaaaaa
gataaagggaaattgaaaaaatctagcagggagaagaggattaagcgaaaaagaagatac
tcgtcttcctcagattcatatagctcaagttctgaatcagaaacagattcatcctctagt
tcttccagtgatgggaagcgtaggaagaggaggaggtcaacaaagagacacaaaggccga
cgcggggaaagcaatatcaaaggacgaaaggggaaaaagaatgctcgaggagatagacca
cctcagcgcagaaacaaggatagttcaagtgacaccgagagtagcaattctgatgacgag
agaatgggccacgaaaaggccaaaaagtcaaagaaagctaaagatggtgtgcctgctgct
gattctagtcctgcggagaagaaattttcgggggagtctcttctgaatgaaaatgaactt
gtcggtaatggaaaagccaccaaagttgataatgactcagtgaaatcgaggagtatgagc
ccagcttctagaagagatcaaaacagtaagaggagcaaaggtgtgaggaaatctccaaat
ggtgagcccaagcgcatccgaaaggggcgtgggttcacagaacgttattcatttgctcgg
aagtaccgtacaccatctcctgagcgttcccctccgagaagaagctttcaggacaggaac
acgagggacaggtatccaagcaacaggagttactctgaacgctcgcgatttaggagccca
ccaaggagaaggagccctccaaggtacaaccggaggagaagaagcatttcacggagtcca
gatgggcagcgcagacgttggagagagagccaaagtccaagtcatcgtagccctagcccc
agaaagaggcagccaattagccaagaccttaaatcccgtctggggccacaaagatctcct
cccgtcataggaggaggacgcacgtctcctgcacaatcgctcagcgcttcgccctcaacc
tccccatcgggacagagaggtttggttagctatgcagattga

DBGET integrated database retrieval system