KEGG   Brassica oleracea (wild cabbage): 106343588Help
Entry
106343588         CDS       T04124                                 

Definition
(RefSeq) apyrase 1
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00230  Purine metabolism
boe00240  Pyrimidine metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106343588
   00240 Pyrimidine metabolism
    106343588
Enzymes [BR:boe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     106343588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 Ppx-GppA Bacteriocin_IIi
Motif
Other DBs
NCBI-GeneID: 106343588
NCBI-ProteinID: XP_013638294
UniProt: A0A0D3CMW1
Position
C5
AA seq 468 aa AA seqDB search
MTAKRAIGRHESLSDKIHRHRGLLLLISIPVVLITLVILLMPGASTSVIEEYALKSSEGG
GSNSRKYAVIFDAGSSGSRVHVYCFDENLDLVPLENELELFLQLKPGLSAYPNDPRQSAN
SLVSLLDKAEASVPHELRPKTPVRVGATAGLRALGHKASENILQAVRELLKDRSRLKTEA
NAVTVLDGAQEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEEDAATAPK
PLQGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKY
GGKAFKAAASSSGASLDECRRVALNALKVNDSVCTHMKCTFGGVWNGGGGGGQKNMFVAS
FFFDRAAEAGFVDPTQPVATVRPADFEEAATQACNMKMGEGKSKFPRVEEDNLPYLCLDL
VYQYTLLVDGFGLKPSQTITLVKKVKYGERAVEAAWPLGSAIEAVSSL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaagcgagcgatcgggaggcacgagtctctctccgataagatccatcggcat
cgcggtctcctgctcctgatctcgattcccgtcgtgctgatcacactcgtgatcctgttg
atgccgggggcgtcgacctccgtcatcgaggagtacgcgttgaaaagtagcgaaggagga
ggctcgaattcgaggaagtacgctgtgatcttcgacgcggggagctcgggaagccgcgtg
catgtttactgttttgatgagaatttggatctcgttcctttggagaatgagctcgagctc
ttccttcagctaaaaccagggttgagtgcgtatcctaatgatcctaggcaatcagcaaac
tctttggtatctcttcttgacaaagcagaggcttctgttccccatgagttgcgtcctaag
actcctgtcagagttggggcaactgctggtttgagggctttgggtcataaagcttctgaa
aacattttgcaagcggttagggagctcctgaaagatagaagcaggttgaagactgaggca
aatgcagttactgttctagatggtgctcaggaaggttcttaccaatgggtgaccatcaac
tacttgctaaaaactttgggaaagccttactcagaaacagttggagtggttgatctcgga
gggggatctgttcagatggcatatgctatatcagaggaagatgctgcaaccgcaccaaaa
ccattacaaggcgaggattcttatgtcagagaaatgtatctcaagggacggaagtatttc
ctatatgttcacagctacctacattacgggttattggctgcacgagcagagattttgaaa
gtttctgagggctctaacaacccctgcattgtgaccggctatgatggtacttacaagtat
ggtggaaaagcattcaaagccgcagcttcttcatctggtgcaagtctagacgaatgcagg
cgagtagctcttaacgcactcaaagtcaatgattcagtgtgtacacacatgaaatgcaca
ttcggtggagtttggaacggtggaggcggtggtggccagaagaatatgtttgtcgcatca
tttttctttgatagagccgcagaggctggttttgttgacccgacgcaacctgtggctact
gttcgtccagctgactttgaggaagcagctacccaagcgtgtaacatgaaaatgggagaa
ggcaaatcgaagttcccacgtgtggaggaagacaatcttccttacctgtgcttggatctt
gtttaccaatatactctcctcgttgatggattcggattgaagccatcacagacaataacg
ttagtgaagaaagtgaaatacggagaacgcgccgtggaagctgcgtggccactaggaagc
gccatagaggccgtatcctcactatga

DBGET integrated database retrieval system