KEGG   Bordetella sp. H567: AKI39_08140Help
Entry
AKI39_08140       CDS       T04979                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
boh  Bordetella sp. H567
Pathway
boh00071  Fatty acid degradation
boh00072  Synthesis and degradation of ketone bodies
boh00280  Valine, leucine and isoleucine degradation
boh00310  Lysine degradation
boh00362  Benzoate degradation
boh00380  Tryptophan metabolism
boh00620  Pyruvate metabolism
boh00630  Glyoxylate and dicarboxylate metabolism
boh00640  Propanoate metabolism
boh00650  Butanoate metabolism
boh00900  Terpenoid backbone biosynthesis
boh01100  Metabolic pathways
boh01110  Biosynthesis of secondary metabolites
boh01120  Microbial metabolism in diverse environments
boh01130  Biosynthesis of antibiotics
boh01200  Carbon metabolism
boh01212  Fatty acid metabolism
boh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:boh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AKI39_08140
   00630 Glyoxylate and dicarboxylate metabolism
    AKI39_08140
   00640 Propanoate metabolism
    AKI39_08140
   00650 Butanoate metabolism
    AKI39_08140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AKI39_08140
   00072 Synthesis and degradation of ketone bodies
    AKI39_08140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKI39_08140
   00310 Lysine degradation
    AKI39_08140
   00380 Tryptophan metabolism
    AKI39_08140
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AKI39_08140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AKI39_08140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AKI39_08140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:boh04147]
    AKI39_08140
Enzymes [BR:boh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AKI39_08140
Exosome [BR:boh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AKI39_08140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOB30669
UniProt: A0A1B2R0Y6
Position
1793877..1795058
Genome map
AA seq 393 aa AA seqDB search
MKEVIIAAGARTAVGTFGGALKDVPPIDLGSTAIREALARAGVDGGEVGHVAVGHVINTE
PRDMYLSRVAALNAGVGKETPAFNVNRLCGSGLQAIVSAAQSIMLGDTDIAVGAGAENMS
RGPYISPAQRWGSRMGDATLSDMMVGALTDPFQRIHMGVTAENVASKYEVSRADQDALAL
ESHRRAAAAIDAGYFKDQIVPVVIKTRKGEVRFEVDEHVRRDVDTDSMAKLKPVFQKENG
TVTAGNASGINDGAAAVVLMSADAAGKRGVKPLARLVAYGHAGVDPAYMGIGPVPATQAA
LKRAGLSIDQLDVVEANEAFAAQACAVTRQLGLDPAKVNPNGSGIALGHPIGATGAIITV
KALYELQRIKGRYALVTMCIGGGQGIAAIFERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtcatcattgccgccggcgcgcgaaccgcggtgggcacattcggcggcgcg
ctcaaggacgtacccccgatcgatctgggcagcacggcgatccgcgaggcgctggcgcgc
gccggcgtcgacggtggcgaagtgggccacgtcgcggtgggccacgtcatcaataccgaa
ccgcgcgatatgtacctgtcgcgcgtcgccgcgctgaatgcgggggtcggcaaggaaaca
cccgccttcaacgttaatcgcctgtgcggttcgggcctgcaggccatcgtgtcggcggcg
cagtccatcatgctgggcgacacggatatcgccgtgggcgcgggcgcggaaaacatgagc
cgcgggccctacatatcgccggcgcagcgctggggttcccgcatgggcgacgcgacgctg
tcggacatgatggtgggggcgctgaccgatcccttccagcgcatccacatgggcgttacc
gccgaaaacgtcgcgtccaagtacgaagtcagccgcgccgaccaggacgcgctggcgctg
gaatcgcaccgccgcgcggcggccgccatcgatgcgggttatttcaaggaccagatcgtt
ccggtcgtcatcaagacccgcaagggcgaggtgcgcttcgaggtcgacgagcatgtgcgg
cgcgacgtcgataccgattccatggccaagctcaagcccgtattccagaaggagaacggg
accgtcacggcgggcaatgccagcggcatcaacgacggcgcggccgccgtggtgctgatg
agcgcggacgccgccggcaagcggggcgtgaagccgctcgcgcgcctggtggcctatggc
cacgcgggcgtggacccggcctacatgggcatcggcccggtgcccgccacgcaggccgcc
ctgaagcgggcggggctgagcatcgaccagctcgatgtcgtcgaggccaacgaagccttt
gccgcgcaggcctgcgccgtcacgcgccaactgggactggacccggccaaggtgaacccc
aacggcagcggtattgcgctgggccatcccatcggcgccacgggggccatcatcacggtc
aaggccttgtacgagctgcagcgaatcaaggggcgctacgcgctggtcacgatgtgcatc
ggcggcgggcagggcattgccgcgattttcgagcgaatctga

DBGET integrated database retrieval system