KEGG   Bordetella sp. H567: AKI39_14110Help
Entry
AKI39_14110       CDS       T04979                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
boh  Bordetella sp. H567
Pathway
boh00480  Glutathione metabolism
boh00590  Arachidonic acid metabolism
boh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AKI39_14110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AKI39_14110
Enzymes [BR:boh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AKI39_14110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA EF-hand_5 Redoxin
Motif
Other DBs
NCBI-ProteinID: AOB33732
UniProt: A0A1B2R9S7
Position
3147202..3147687
Genome map
AA seq 161 aa AA seqDB search
MTSLADFSAIDIDGTQRSLGDYAGRVVLVVNVASRCGFTPQYAGLEALYRKHCDAGFTVL
GFPCDQFRHQEPGDEAEIKRFCALRYDVTFPLFSKIDVNGDGAHPLYRWLKRERPGLLGT
QSIKWNFTKFLIGRDGQPIRRYGPVDKPEAIAPAIVAACGS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccttgccgatttttccgccatcgatatcgacggcacgcagcgttcgctgggc
gactatgcaggtcgcgtggtgctggtcgtcaacgtcgcgtcccgctgcggcttcacgccg
cagtatgccggcctggaagcgctgtaccgcaaacattgcgatgccggattcacggtactg
ggctttccctgcgaccagttccgccatcaggagcccggggacgaagcggagatcaagcgc
ttttgcgccctgcggtatgacgtgacgttcccgctgttctccaagatcgacgtcaacggc
gacggcgcccaccccttgtaccgctggctcaagcgcgagcgcccggggctgcttggcacg
cagtccatcaaatggaatttcaccaaattcctgatcggacgcgacgggcagccgatccgg
cgctatggtccggtggacaagccggaagcgatcgcgcccgcgatcgtcgcggcctgcggc
agctag

DBGET integrated database retrieval system