KEGG   Bordetella sp. H567: AKI39_21805Help
Entry
AKI39_21805       CDS       T04979                                 

Definition
(GenBank) diguanylate cyclase
  KO
K21020  diguanylate cyclase [EC:2.7.7.65]
Organism
boh  Bordetella sp. H567
Brite
Enzymes [BR:boh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     AKI39_21805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF
Motif
Other DBs
NCBI-ProteinID: AOB32809
UniProt: A0A1B2R752
Position
complement(4874719..4875519)
Genome map
AA seq 266 aa AA seqDB search
MKKRYQNLETRIQSMLDEPGYAGHPLRGVLEELWQHTNEQLERIERISYLSDAFQMMARQ
RELGLVARYDRELKRLAKLVRISDGYQEMMRDMNAALKESSIRDPLTNLLNRRALMERMK
ELSLAADADQPAFVVAMLDVDHFKRINDRYGHDAGDRALTRLADIMRCSVRESDDVARWG
GEEFLVLLPNISLEEGEAVIDRILAGVRGNAIEVQGEQLLLTVSVGMALHRTGESVSTTL
SRADRALYLAKQAGRDRVALERRPAV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgctaccagaatctcgaaacgcgtatccagtccatgctggatgagcccggc
tatgcgggtcatccgctgcgcggcgtgctcgaggaactctggcagcacacgaacgaacag
ctggaacgcatcgagcggatctcgtacctctccgacgccttccagatgatggcgcggcag
cgtgagctggggctggtggcgcgctatgaccgcgaattgaagcgcctggccaagctggtg
cgcatctccgacggctaccaggaaatgatgcgcgacatgaatgccgcgctcaaggaatcg
tcgatccgcgatcccttgaccaatctgttgaaccgccgtgcgctgatggagcgcatgaag
gaactgtccctggccgcggacgccgatcaaccggccttcgtcgtcgcgatgctggacgtg
gaccatttcaagcgcatcaacgatcgctatgggcatgacgccggcgaccgcgcgctgacc
cgcctggcggacatcatgcgctgctctgtacgtgaaagcgacgacgtcgcccgctggggc
ggcgaggaattcctggtgctgttgccgaacatcagcctggaagagggcgaagccgtcatc
gaccggatcctggcgggagtgcggggcaacgcgatcgaggtccaaggcgaacaactgctg
ttgacggtcagcgtggggatggctttgcatcgcaccggtgaaagcgtttccactaccttg
agccgggcggatcgtgccttgtacctggcgaaacaagcaggccgcgatcgtgtcgcgctg
gagcgtcggccggcggtttga

DBGET integrated database retrieval system