KEGG   Bosea sp. Tri-49: BLM15_00050Help
Entry
BLM15_00050       CDS       T05753                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00670  One carbon pool by folate
boi01100  Metabolic pathways
boi01120  Microbial metabolism in diverse environments
boi01200  Carbon metabolism
Module
boi_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BLM15_00050
Enzymes [BR:boi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BLM15_00050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AZO76167
Position
9056..10729
Genome map
AA seq 557 aa AA seqDB search
MSTDIEIARAATLKAIGTVAEEAGIPDAALHPYGKYIAKVDTGAIPEFAEKPGGKLILVT
AISPTPAGEGKTTTTVGLGDGLRRLGKRTMIALREPSLGPCFGQKGGAAGGGYAQVVPME
QINLHFTGDFHAITSAHNLLAAMLDNHIYWGNGLDLDERHIAWRRVVDMNDRALRAIVSS
LGGAMNGFPREDGFDITVASEVMAIFCLARDLADLEERLGRIVIGRTRSKRPVTAAELNA
QGAMTVLLRDALMPNLVQTLEGTPAFVHGGPFANIAHGCNSVIATRAALKLADYVVTEAG
FGADLGAEKFFDIKCRKAGLKPDVAVVVATVRALKMHGGVARDRLGTENLKALEAGLSNL
ARHVENIRKFGVPAIVAINHFTSDTAAEHALIQHYCRNHLGVEAVICRHWAEGGAGTDEL
ATKVAALTDGGEADFAPLYPDAMPLRQKLETIAREVYGAAGISADAKVTARFAELEAAGY
GNLPVCVAKTQYSFSADPTLRGAPSGHTVPVRELRLSAGAGFVVAICGDIMTMPGLPRQP
AAERIYIDAHGQIEGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgatatcgagattgcccgcgcggcgacgctgaaggccatcggtaccgtagcc
gaggaggccggcatcccggatgcggcgctgcatccctatggcaagtacatcgccaaggtc
gataccggcgcgattcccgaattcgcggagaagccgggcggcaagctcatcctcgtgacc
gcgatcagcccgacgccggctggcgagggcaagaccacgacgacggtcggcctcggcgac
gggctgcggcgcctcggcaagcgcaccatgatcgccctgcgcgagccttcgctcggtccc
tgcttcgggcagaagggcggggcggccggcggcggctatgcccaggtcgtgccgatggag
cagatcaatctgcacttcaccggcgatttccacgccatcaccagcgcccacaacctgctg
gcggcgatgctcgacaaccatatctactggggcaacgggctcgatctcgacgagcgccac
atcgcctggcggcgcgtggtcgacatgaacgaccgggcgctgcgcgcgatcgtctcctcg
ctcggcggcgccatgaacggcttcccgcgcgaggacggcttcgacatcaccgtcgcctcg
gaggtgatggcgatcttctgcctcgccagggatctcgcggatctggaggagcggctcggg
cgcatcgtcatcggccgcacccgcagcaagcgcccggtcacggcggccgagctcaacgcc
cagggcgcgatgacggtgctcttgcgcgatgcgctgatgccgaacctggtgcagacgctg
gagggcacacccgccttcgttcatggcgggcccttcgccaatatcgcccatggctgcaat
tcggtgatcgcgacgcgcgccgcgctgaagctcgccgactatgtcgtgaccgaggccggc
ttcggcgccgatctcggggccgagaagttcttcgacatcaagtgccgcaaggccgggctg
aagccggatgtcgccgtggtggtcgcgacggtgcgggcgctcaagatgcatggcggcgtc
gctcgcgacaggctcggcaccgagaacctgaaagcgctggaggcgggcttgtcgaacctc
gcccgccatgtcgagaacatcaggaagttcggcgtgccggcgatcgtcgcgatcaaccat
ttcaccagcgacacagccgcagagcacgcgctgatccagcactattgccgcaaccatctc
ggcgtcgaggcggtgatctgtcggcattgggccgagggcggggcgggtaccgacgagctc
gcgaccaaggtcgcggcgctgaccgacggtggcgaagcggatttcgcgccgctctatccg
gatgcgatgccgctgcgccagaagctcgagacgatcgcgcgcgaggtctatggcgcggcc
ggcatctcggcagatgccaaggtgacggcccgcttcgccgagctcgaggcggccggctat
ggcaacctgccggtctgcgtggcgaagacgcaatattccttctcggccgatccgaccctg
cgcggtgcgccgtcgggccacacggtgccggtgcgcgagctccggctctcggccggcgct
ggcttcgtcgtggcgatctgcggggatatcatgaccatgcccggcctgccgcgccagccg
gcggcggagcgcatctacatcgacgcgcacggccagatcgaagggctgttctag

DBGET integrated database retrieval system