KEGG   Bosea sp. Tri-49: BLM15_00070Help
Entry
BLM15_00070       CDS       T05753                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00361  Chlorocyclohexane and chlorobenzene degradation
boi00625  Chloroalkane and chloroalkene degradation
boi01100  Metabolic pathways
boi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLM15_00070
   00361 Chlorocyclohexane and chlorobenzene degradation
    BLM15_00070
Enzymes [BR:boi01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BLM15_00070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AZO76171
Position
complement(14873..15613)
Genome map
AA seq 246 aa AA seqDB search
MPIKAVVFDAYGTLFDVQSVAGVTDAAFPGHGETITQIWRLKQLEYTWLRALMDRYEDFW
SVTKASLDFTLKTLGLEATPDFLARIAAAYDALALYPEALAALQGLAPTRLAIFSNGSPA
MLTNLTRQAGIDTLLETVISVDEIGSYKPDPRGYRLVEERLGLTRDEILFVSSNGFDIAG
AKAYGMTVARIERVTQQALREELVTGPIGPKSLFKALRMQEEQLGAGADLTISSLSELVP
YVAARR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaaggccgtcgtcttcgatgcctacggaaccctgttcgacgtgcagtcggtc
gccggcgtcaccgatgccgccttccccggccatggcgagaccatcacccagatctggcgc
ctaaagcagctcgaatacacctggctgcgggcgctgatggatcgctacgaagatttctgg
agcgtgacgaaagcctcgctcgacttcacgctgaagacgctcggcctcgaggccacgccc
gatttcctcgcccgcatcgccgcggcctatgacgcgctcgcgctttatccggaagcgctg
gcggcgctgcagggcctcgccccgacacgcctcgccatcttctccaatggcagcccggcc
atgctgaccaatctcacccgacaggccggcatcgacacattgctggaaaccgtgatcagc
gtcgacgagatcggcagctacaagcctgatccacgcggctatcgcctggtcgaggagcgg
ctcggcctgacgcgcgacgagatcctgttcgtctcctccaacggcttcgacatcgccggc
gccaaggcctacggcatgacggtggcgcgcatcgagcgggtgacacagcaggctctgcgc
gaggagttggtgaccggcccgatcggtcccaagagcctgttcaaggcgctgcgcatgcag
gaggagcagctcggcgcaggcgcggatctgacgatctcgtcgctgagcgagttggtgcct
tatgtcgccgcgaggcgatga

DBGET integrated database retrieval system