KEGG   Bosea sp. Tri-49: BLM15_00395Help
Entry
BLM15_00395       CDS       T05753                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00051  Fructose and mannose metabolism
boi01100  Metabolic pathways
boi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BLM15_00395
Enzymes [BR:boi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BLM15_00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AZO76224
UniProt: A0A3Q9AKL5
Position
81848..82492
Genome map
AA seq 214 aa AA seqDB search
MNEQALRQEIVEVAQAIDRAGFCPSKSGNVSARFEGGLLITPSGLPYARTKPEDLIHLSL
DGTVVSGGRKPSSEWPFHVEIYKARPDAQAIVHTHSPRATALSSARRGIPAFHYMIALCG
GADVRCADYATFGSPELAANAVRALEGRKAVLLANHGVIALGASLAGAHTIVAEVENLAG
QYLDLLASGLEPVILDAAEMERVSARFAGYGKVG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcaggcgttgcggcaggagatcgtcgaggtcgcgcaggcgatcgaccgcgcc
ggcttctgcccgtcgaaatcgggcaatgtctcggcccgcttcgaaggcgggttgctgatc
accccgtcgggcctgccctatgcaaggacgaagccggaggacctgatccatctctcgctc
gatggcacggtcgtgtcgggcgggcgcaagccctcgtcggaatggccgttccacgtcgaa
atctacaaggcgcgcccggatgcgcaggcgatcgtccacacgcactcgccgcgggcgacg
gcactgtctagcgcgcgccgcggcattccagccttccactacatgatcgccctatgcggc
ggcgctgatgtgcgctgtgccgactatgcgaccttcggctcgccggagctcgctgccaac
gcggttcgagcgctggaaggtcgcaaggccgtgctgctcgccaatcacggcgtgattgcg
ctcggcgcgagcctggcgggcgcgcacaccatcgtcgccgaggtcgagaatctcgccggg
cagtatctcgacctgctggcgtcggggctcgagccggtcatcctcgatgcggccgagatg
gagcgcgtttcggccaggttcgcgggttacggaaaggtcggttga

DBGET integrated database retrieval system