KEGG   Bosea sp. Tri-49: BLM15_07855Help
Entry
BLM15_07855       CDS       T05753                                 

Definition
(GenBank) 3-deoxy-8-phosphooctulonate synthase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00540  Lipopolysaccharide biosynthesis
boi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BLM15_07855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:boi01005]
    BLM15_07855
Enzymes [BR:boi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     BLM15_07855
Lipopolysaccharide biosynthesis proteins [BR:boi01005]
 Unusual sugar
  BLM15_07855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AZO77537
UniProt: A0A3S9G209
Position
1607844..1608713
Genome map
AA seq 289 aa AA seqDB search
MTANAIVTVGAELARPVRFGNGLPLALIAGPCQMESRDHALEIAQALKETAEKLGIGLVF
KASFDKANRTSVKGQRGMGLEAALPVYAEIRERTGMPVLTDIHDVSQCAPVAEVVDILQI
PAFLCRQTDLLVAAAKTGRVVNVKKGQFLAPWDMVNVAAKVTDSGNPNVMLTERGASFGY
NTLVTDMRSLPIMAEIGAPVIFDATHSVQQPGGKGASTGGQREFVPVLARAAVAVGVAGV
FIETHPDPDNAPSDGPNMVPLRDFHALIAELQEFDRLAKRAAHSTLAYV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaacgccatcgtcactgtgggcgccgagctcgccaggcccgtccgattcggt
aacggcctgccactcgccttgattgctggcccctgccagatggagagccgcgatcacgcg
ctcgagatcgctcaggccctaaaggagacagccgagaagctcggcatcggccttgtgttc
aaggcgtctttcgacaaggccaaccgcaccagtgtgaagggccagcgtggcatggggctc
gaggccgccctgcccgtctacgccgagattcgcgagcgcaccggcatgcctgtgctgacc
gatatccacgatgtgagccaatgcgcgccggtcgccgaggttgtcgatatcctgcagatt
ccggccttcctctgccggcagaccgacctgctcgtcgccgccgccaagaccggccgcgtc
gtcaacgtcaaaaagggccagttcctggcgccctgggacatggtcaatgtcgccgccaag
gtgaccgacagcggcaatccgaacgtgatgctcaccgagcgcggcgcctccttcggctac
aacacgctggtcaccgatatgcgcagtctgccgatcatggcggagatcggtgcgcccgtg
atcttcgacgcgacccattcggtgcagcagccgggcggcaagggcgcatcgaccggcggt
cagcgcgaattcgtgccggtactggcccgggcagcggtcgctgtcggcgtcgccggcgtc
ttcatcgagacgcatccggatccggacaacgcgccgtcggacgggccgaacatggtgccg
ctgcgcgacttccatgcgctgatcgcagagctgcaagagttcgatcgccttgccaagcgt
gcggcgcactctacgctggcgtatgtctga

DBGET integrated database retrieval system