KEGG   Bosea sp. Tri-49: BLM15_09405Help
Entry
BLM15_09405       CDS       T05753                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00010  Glycolysis / Gluconeogenesis
boi00053  Ascorbate and aldarate metabolism
boi00071  Fatty acid degradation
boi00280  Valine, leucine and isoleucine degradation
boi00310  Lysine degradation
boi00330  Arginine and proline metabolism
boi00340  Histidine metabolism
boi00380  Tryptophan metabolism
boi00410  beta-Alanine metabolism
boi00561  Glycerolipid metabolism
boi00620  Pyruvate metabolism
boi00625  Chloroalkane and chloroalkene degradation
boi00903  Limonene and pinene degradation
boi01100  Metabolic pathways
boi01110  Biosynthesis of secondary metabolites
boi01120  Microbial metabolism in diverse environments
Module
boi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLM15_09405
   00053 Ascorbate and aldarate metabolism
    BLM15_09405
   00620 Pyruvate metabolism
    BLM15_09405
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BLM15_09405
   00561 Glycerolipid metabolism
    BLM15_09405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BLM15_09405
   00310 Lysine degradation
    BLM15_09405
   00330 Arginine and proline metabolism
    BLM15_09405
   00340 Histidine metabolism
    BLM15_09405
   00380 Tryptophan metabolism
    BLM15_09405
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BLM15_09405
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BLM15_09405
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLM15_09405
Enzymes [BR:boi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BLM15_09405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AZO77811
Position
1913509..1915005
Genome map
AA seq 498 aa AA seqDB search
MTIVPRQPDMHLAFLEGGPKKLLIDGRWVDAASGKTFETLDPSTGQVLARVAEGDRQDID
AAVAAARRAFDGPWRKFKPYDRQQVILKLADLVDKHFDELSLIDTLDMGAPISRTRASRR
RLLGLLRYYAGMATALHGETVDNSMPGEFVTYTLKEPVGVVGAITPWNGPLVSWIWKIGP
VLATGCTTVLKPAEESPLSALRMGELLLEAGLPDGVVNIVTGFGETAGAALAGHPDVDKI
AFTGSFETGQKIVQASVGNLKRVTLELGGKSPDIVFADVDLDLAVPGAAMGCFGNSGQVC
SAGTRLFVEDKIYDEFMERVAAFSRTLKVGNSLDPEVQIGPLVSEQQLSRVSSYLDIGQQ
EGAKLLSGGRRLTEDELASGYFIPPTVFAGVRDEMRIAQEEIFGPVVSSLPFSDLEEVAR
RANNTMYGLGSGVWTNDVRKAHYLAKAIRAGSVWINCYQMMDPAMPFGGYKRSGYGRESG
MQQFNDYLNVKSVWLRTA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgtgccaaggcaacccgacatgcacctcgccttccttgaaggcggaccgaag
aaactgctgatcgatggacgctgggtcgatgccgcctccggcaagaccttcgagaccctc
gacccatcgaccggccaggtactggcgcgcgtcgccgagggcgatcggcaggacatcgat
gcggcggtcgcggcggcgcggcgcgccttcgacggcccctggcgcaagttcaagccctat
gaccgccagcaggtcatcctcaagctcgccgacctcgtcgacaagcatttcgacgagctc
tcgctgatcgacacgctcgacatgggcgccccgatcagccgcacgcgcgcctcgcgccgg
cgcctgctcggcctgctgcgctattatgccggcatggcaacggcgttgcatggcgagacc
gtcgacaactccatgcctggcgagttcgtcacctatacgctgaaggagccggtcggcgtc
gtcggcgcgatcacgccgtggaacggcccgctggtctcctggatctggaagatcggcccg
gtcctcgccaccggctgcaccaccgtgctgaagccggctgaagagtcgccgctctcggcc
ctgcgcatgggcgagctcctgctcgaagccggcctgcccgatggcgtcgtcaacatcgtc
accggcttcggcgagactgcgggggcggcgctcgccggccatcccgacgtcgacaagatc
gccttcaccggctccttcgagaccgggcagaagatcgtccaggcctcggtcggcaacctc
aagcgcgtgacgcttgagctcggcggcaagtcgcccgatatcgtcttcgccgatgtcgat
ctcgacctcgccgtgcccggcgccgccatgggctgcttcggcaattccggccaggtctgc
agcgccggcacccgcctcttcgtcgaggacaagatctatgacgagttcatggagcgcgtc
gccgccttcagccggacactgaaggtcggcaacagcctcgaccccgaggtccagatcggg
ccgttagtctccgaacagcagctcagccgcgtttccagctatctcgacatcggccagcag
gagggcgccaagctgctttccggcgggcgccggctgaccgaggacgagctcgccagcggc
tatttcatcccgccgaccgtcttcgccggcgtccgcgacgagatgcggatcgcgcaggag
gagatcttcgggccggtggtgtcgagcctgcccttcagcgatctggaggaagtcgcacgg
cgcgccaacaataccatgtacgggctcggcagcggtgtctggaccaatgacgtgcgcaag
gcccactatctcgccaaggcgatccgcgccggctcggtctggatcaactgctaccagatg
atggatccggcgatgcccttcggcggctacaagcgcagcggctacggccgcgaatccggc
atgcagcagttcaacgactatctgaacgtgaagtcggtctggctgcggaccgcctga

DBGET integrated database retrieval system