KEGG   Bosea sp. Tri-49: BLM15_17020Help
Entry
BLM15_17020       CDS       T05753                                 

Definition
(GenBank) glyoxylate/hydroxypyruvate reductase A
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00260  Glycine, serine and threonine metabolism
boi00620  Pyruvate metabolism
boi00630  Glyoxylate and dicarboxylate metabolism
boi01100  Metabolic pathways
boi01110  Biosynthesis of secondary metabolites
boi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLM15_17020
   00630 Glyoxylate and dicarboxylate metabolism
    BLM15_17020
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLM15_17020
Enzymes [BR:boi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     BLM15_17020
    1.1.1.81  hydroxypyruvate reductase
     BLM15_17020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 UDPG_MGDP_dh_N NAD_Gly3P_dh_N 3HCDH_N F420_oxidored IlvN ApbA
Motif
Other DBs
NCBI-ProteinID: AZO79123
Position
complement(3522552..3523478)
Genome map
AA seq 308 aa AA seqDB search
MTLLLKSDAARGEEWTRLLAQKAPELPFRIWPDIGDPADIRYLAAWLPPDNLLGQFPNLE
LLVSVGAGVDQLNLADIPPQLPIVRMIEPGLVDSMVEYVTMSVLALHRDLVPYIAAQREQ
AWKPLRIRPTSERRVGVLGLGMLGKACALKLAEFGFEVAGWSRSRHKVDGIETFAGDDEL
PAFLARTDILICLLPLTDATRGLLGAELFAQLPQGAMLVNAGRGGHLDQDALLAALDNDH
LAAAVLDVCEPEPLPAGHPLWNHPKVLLTPHIASRSRSEASLDIVLENLRRHQAGEPLIG
LIDRHRGY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgctactgctcaagtccgatgccgcccgcggcgaggaatggacgcggctattggcg
cagaaggcgcccgagctgccgtttcggatctggccggatatcggcgaccccgccgatatc
cgctatcttgccgcctggcttccgcccgacaacctgctcggccagttccctaatctcgaa
ttgctggtctcggtcggcgccggtgtcgaccagctgaacctggctgacataccgccgcag
ctgccgatcgtgcggatgatcgagcccggcctcgtcgacagcatggtcgaatacgtcacc
atgtcggtcctggccctgcaccgggatctcgtcccctacatcgcggcacagcgcgaacag
gcctggaagccgctccgtatcaggccgacgtcagagcgccgagtcggcgtgctcgggctc
ggcatgctcggcaaggcctgcgcgctgaagctcgccgaattcggtttcgaggtcgccggc
tggagccgttcgcggcataaggtcgacggcatcgagaccttcgccggcgatgacgaactg
ccggccttcctcgcccgcaccgacatcctgatctgcctgctgccgctgaccgatgcgacg
cgcggcctgctcggcgccgagctcttcgcccagctgccgcagggcgcgatgctggtcaat
gccggccggggcggccatctcgatcaggatgccctgctggcggcgctggacaacgaccat
ctcgcggcggcggtgctggatgtctgcgagccggagccgttgccggcagggcatccgctc
tggaaccatcccaaggtcctgctcacgccgcatatcgccagccgctcgcgctcggaggcc
tcgctcgacatcgtccttgagaacctgcggcgccaccaggcgggcgaacccctgatcggc
ctgatcgaccgccatcgcggctactga

DBGET integrated database retrieval system