KEGG   Bosea sp. Tri-49: BLM15_20470Help
Entry
BLM15_20470       CDS       T05753                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
boi  Bosea sp. Tri-49
Brite
KEGG Orthology (KO) [BR:boi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BLM15_20470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AZO79707
Position
4272596..4272988
Genome map
AA seq 130 aa AA seqDB search
MYQAETHGVRVTASPKFMDSESTPNQSRYFWAYTIEIENFSPRTVQLMTRHWFITDGRGE
MHEVRGDGVIGQQPVLQPGERFSYTSGCPLMTPDGSMRGFYAMLGEDGVIFDVEVPLFPL
DSPYVKKVLH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaagccgaaacgcatggcgtgcgcgttaccgcctcgcccaagttcatggacagc
gagtccacgcccaatcagagccgctatttctgggcctacacgatcgagatcgagaatttc
tcgccgcgcaccgtgcaattgatgacgcgccactggttcatcaccgacgggcgcggcgag
atgcacgaggtccgcggcgacggcgtgatcggccagcagccggtgctgcaaccgggcgag
cgcttcagctatacctccggctgcccgctgatgacccccgatggcagcatgcgcggcttc
tacgccatgctcggcgaggacggcgtgatcttcgatgtcgaggtgccgcttttcccgctc
gactcgccctatgtgaagaaggtcctgcattga

DBGET integrated database retrieval system