KEGG   Bosea sp. Tri-49: BLM15_22445Help
Entry
BLM15_22445       CDS       T05753                                 

Definition
(GenBank) phosphonate C-P lyase system protein PhnH
  KO
K06165  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH [EC:2.7.8.37]
Organism
boi  Bosea sp. Tri-49
Pathway
boi00440  Phosphonate and phosphinate metabolism
boi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BLM15_22445
Enzymes [BR:boi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BLM15_22445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnH
Motif
Other DBs
NCBI-ProteinID: AZO80041
UniProt: A0A3S9G995
Position
complement(4671875..4672480)
Genome map
AA seq 201 aa AA seqDB search
MTPNDTLIGAGFADPVFQSQGAFRALLAALSEPGLACDIGVSVETPAGLELATAVALLTL
ADYETPIWLPAALRDGAAGAWLRFHCGAALVDDPARAAFAVIDGAAAEPKLAAFNAGDDQ
FPDRSTTVLIQCAGLASGDTVTLEGPGIAGRRTIAPAGLRPGFWAEVADNAVLYPLGVDL
LLVHGTQALGLPRSTQIAEAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgactcccaacgacaccctcatcggcgccggtttcgccgatcccgtcttccagtcgcaa
ggcgccttccgcgctctgctggcggcgctgtccgagccgggccttgcttgcgacatcggc
gtttcggtcgagacgcccgcagggcttgagctagcgactgccgtcgcgctgctgacgctc
gccgactacgagacgccgatctggctgccggccgccctgcgcgacggcgcggccggcgcc
tggctacgcttccattgcggcgccgccctggtcgatgatcccgcccgcgccgccttcgcc
gtgatcgacggcgccgcggccgagccgaagctcgccgccttcaacgccggcgacgaccag
ttccccgaccgctcgaccacggtgctcatccaatgcgccgggctcgcaagtggcgacacg
gtcacgcttgaaggtcccggcatcgccggccggcgcaccatcgcccccgctggcctgcgc
ccgggcttctgggccgaggtcgcggataacgcggtgctctacccgctcggcgtcgatctc
ctgctggtccatggcacgcaggcgctcggcctgccgcgctcgacccaaatcgcggaagcc
cgctga

DBGET integrated database retrieval system