KEGG   Bosea sp. Tri-49: BLM15_24995Help
Entry
BLM15_24995       CDS       T05753                                 

Definition
(GenBank) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
boi  Bosea sp. Tri-49
Brite
KEGG Orthology (KO) [BR:boi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BLM15_24995
Enzymes [BR:boi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     BLM15_24995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_11 Methyltransf_12 MTS NodS PCMT TehB Ubie_methyltran Methyltransf_4 FtsJ CMAS DOT1 Methyltransf_2 DREV
Motif
Other DBs
NCBI-ProteinID: AZO80458
Position
5224659..5225441
Genome map
AA seq 260 aa AA seqDB search
MTGKVDWDANQYLRFEDERTRPPLDLIQRVRLTDPQLCIDLGCGPGNSTELVAARFPDAK
VEGLDSSPDMLEKARKRLPQLSFTLADLESWSADSRYDLIFANAALQWIPDHPALFARLA
GSLAPGGVLAVQMPNNLSEPSHVSMDEAAAEGPWAARLANARASKAVIGSFSDYRRWLMA
AGCQVDIWQTTYVHALAGHDAIVEWFKSTGLKPYIDPLPAGERDAFLASYREKIAAAYPA
EPDGKVLLRFPRLFILAVRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaaggtcgactgggacgcgaaccagtatctgcgcttcgaggacgagcggacg
cgcccgccgctcgacctgatccagcgcgtgcgcctcaccgatccgcagctttgcatcgat
cttggctgcgggccgggcaacagcactgaactcgtcgccgcccgctttccggatgccaag
gtcgaagggctcgattcctcgccggacatgctggagaaggcgcgcaagcgcctgccgcag
ctctccttcactctggccgatctggagagctggtcggccgatagccgctacgacctgatc
ttcgccaatgcggcgctgcaatggattcccgaccatcccgccctgttcgcccgattggcc
gggtcgctggcgccgggcggtgtgctcgccgtgcagatgccgaacaatctgagcgagccc
tcgcatgtttcgatggacgaggccgccgccgaggggccctgggcggcccgcctcgccaat
gcgcgggcctcgaaggcggtgatcggctcgttctcggactatcggcgctggctgatggcg
gccggctgccaggtcgatatctggcagacgacctatgtccacgcgctcgccggccacgat
gcgatcgtcgagtggttcaagagcacgggcctcaagccctatatcgacccgctgccggcc
ggggagcgcgatgctttcctcgccagctatcgcgagaagatcgcagccgcctatccggcc
gagccggacggcaaggtgctgctgcgtttcccgcgcctgttcatcctcgcggtccgggcg
tag

DBGET integrated database retrieval system