KEGG   Bordetella sp. J329: CBF45_07215Help
Entry
CBF45_07215       CDS       T05850                                 

Definition
(GenBank) phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
boj  Bordetella sp. J329
Pathway
boj00770  Pantothenate and CoA biosynthesis
boj01100  Metabolic pathways
Module
boj_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:boj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CBF45_07215
Enzymes [BR:boj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CBF45_07215
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     CBF45_07215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein CoA_transf_3
Motif
Other DBs
NCBI-ProteinID: AZV93532
UniProt: A0A3T0NE98
Position
complement(1652335..1653546)
Genome map
AA seq 403 aa AA seqDB search
MPELHKKRLVLGLTGGIACYKSAELLRRLGDHGATVDVVMTDAATHFITPVTMQALSGRP
VHTDAWDNRQPNNMPHINLSRGADAIVIAPASADFMARLVQGRADDLLATLCLARTCPLI
LAPAMNREMWDNPATQRNVRQLREDGVIIIGPGSGHQACGETGDGRMLEPAEILAEIIAF
FQPKVLQGKRVLLTAGPTSEPIDPVRVISNRSSGKTGYALARAAFEAGANVTLVSGPTAL
AAPYGVERISVHTALEMHQAVMSRTGEADIFIAVAAVADWRVANPAEHKIKKTDNGRGVP
VLEFIPNPDILASVAALPDGPWCVGFAAETEKLVQHAEEKRQRKGIDLLVGNLAQDVMDG
DDTRLSLFDAAGCHHLPAADKLSAARRLIGEIARRAPQRHHSA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgcacaaaaaacgcctggtactgggcctgaccggcggcatcgcctgctac
aaaagcgccgaactgctgcgccgcctgggcgaccacggcgccacggtggatgtcgtgatg
accgatgccgccacgcatttcatcacgcccgtcaccatgcaggcgctgtccggccggccg
gttcataccgatgcctgggacaaccgccagcccaacaacatgccgcacatcaatctgtcg
cgcggggccgatgccattgtcatcgcccccgcatcggcggatttcatggcgcgcctggta
cagggccgcgccgacgacttgctggcgaccctgtgcctggcccgcacctgcccgctgatc
ctggcacccgccatgaaccgcgaaatgtgggacaaccctgccacacaacgcaacgtgcgc
cagctgcgcgaggacggtgtcatcatcatcggccccggcagcggccaccaggcctgtggc
gagaccggcgacggccgcatgctcgagcccgcggagatcctggcggaaatcatcgccttc
ttccagcccaaggtgctgcagggcaagcgggtgctgctgacggcaggcccgacttccgaa
cccatagacccggtacgcgtcatcagcaaccgctcctcgggcaaaacaggttatgccctg
gcacgcgccgccttcgaggccggggccaacgttaccctggtttcgggcccgacggcgctg
gccgccccttatggcgtcgagcgcatttccgtgcacactgccctggaaatgcaccaagcc
gtcatgagccgtactggcgaagccgatattttcattgcggtcgccgccgtcgcggactgg
cgggtagccaatcctgccgagcacaagatcaagaaaaccgataacggccgtggcgtgccg
gtactggaattcatcccgaatcccgatatccttgccagcgtcgctgccctgcctgatggc
ccctggtgcgtcggctttgccgctgaaaccgagaagctggttcagcacgccgaggaaaag
cgccaacgcaaaggcatagacttgctggtcggtaatcttgcacaggatgtcatggatggc
gacgatacccgcctgagcctgtttgacgccgcaggctgccatcaccttcctgcggccgac
aagctcagcgccgcccggcgcctgataggcgaaatcgcccgccgggcaccgcaacgccat
cacagcgcctga

DBGET integrated database retrieval system