KEGG   Bordetella sp. J329: CBF45_13260Help
Entry
CBF45_13260       CDS       T05850                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
boj  Bordetella sp. J329
Pathway
boj00020  Citrate cycle (TCA cycle)
boj00480  Glutathione metabolism
boj01100  Metabolic pathways
boj01110  Biosynthesis of secondary metabolites
boj01120  Microbial metabolism in diverse environments
boj01130  Biosynthesis of antibiotics
boj01200  Carbon metabolism
boj01210  2-Oxocarboxylic acid metabolism
boj01230  Biosynthesis of amino acids
Module
boj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
boj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:boj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBF45_13260
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBF45_13260
Enzymes [BR:boj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CBF45_13260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh EGF_alliinase
Motif
Other DBs
NCBI-ProteinID: AZV94572
UniProt: A0A3T0NH77
Position
complement(2989150..2990409)
Genome map
AA seq 419 aa AA seqDB search
MSFQHIKVPEQGQKITVNSDGSLNVPDQVIIPFIEGDGVGVDITPVMQSVVAAAVEKAYG
GKRAIHWMEVFAGAKATRVYGPDVLLPDETLDALREYVVSIKGPLAAPVGGGIRSLNVAM
RQRLDLYVCLRPVAYFKGVPAPVREPEKTDVVIFRENSEDIYAGIEFQAESEQTKELIEF
LRNRLGVGNKIRFPDTASLAVKVVSREGTERLVRKAAQYAIDHDRSSITLVHKGNIMKFT
EGSFRDWGYELLRREFDAKPIDGGPWCKFRNPKTGREIIVKDVVADAFLQRSLRRPAEYD
VIATLNLNGDYISDALTAQVGAVGIAPSANLSDSTALFEVTHGTAPRYAGKDYVNPGSEI
LAAAMMLRHLGWVEAAELIVSGMEKAILSKHVTYDFARQLEGAAQVSCSGFGKVMIDQM
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccagcacatcaaggttccagagcagggccagaaaattacagtcaatagcgat
ggctcgctgaatgttcccgatcaggtcatcattcccttcatcgagggcgatggcgtgggc
gtggatattacccctgtcatgcagtcggtcgtggccgctgctgtcgagaaagcctatggc
ggcaagcgcgccatacactggatggaggtcttcgctggtgccaaggcgacgcgggtctac
ggccccgacgtcctgctgccggatgaaaccctggatgcgctgcgcgaatacgtcgtgtcg
atcaagggcccgctggcagcgcctgtcggcggtggcatccggtctctgaacgtcgccatg
cgccagcgcctggacttgtatgtctgcctgcgcccggtggcgtatttcaagggcgtcccg
gcaccggtacgtgaaccggaaaagacggatgtggtcatcttccgtgagaattccgaggat
atttatgccgggattgaattccaggctgagtccgagcagaccaaggaactgatcgaattc
ctgcgcaaccgcctgggcgtgggcaataagatccgcttcccggatacggcgtcgctggcg
gtgaaggtggtgtcccgcgaaggtaccgagcgcctggtgcgtaaggccgcgcagtacgcc
atcgaccacgaccgcagttcgatcacgctggtgcacaagggcaatatcatgaagttcacg
gaaggcagcttccgtgattggggctatgagctgctgcgccgtgaattcgatgccaagcct
attgatggcgggccgtggtgcaagttccgcaatcccaagacgggccgcgagatcatcgtc
aaggatgtggtggcggatgccttcctgcagcgcagcctgcgccgccctgcggaatacgat
gtcatcgccacgctaaatctgaacggcgactacatttccgatgcgttgaccgcacaggtc
ggcgctgtcgggattgctcccagcgccaacctgtccgattccaccgcgctgttcgaagtt
acgcacggcacggcgccgcgctacgctggcaaggattacgtgaatcccggctcggaaatc
ctggcggcggcgatgatgctgcgccacctgggctgggtggaagcggcggagttgatcgtc
tccggcatggaaaaggccattctttccaagcacgtgacctacgattttgcgcgtcagctc
gaaggggctgcccaggtatcgtgctcgggctttggcaaggtcatgatcgaccagatgtaa

DBGET integrated database retrieval system