KEGG   Bordetella sp. J329: CBF45_15110Help
Entry
CBF45_15110       CDS       T05850                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
boj  Bordetella sp. J329
Pathway
boj00270  Cysteine and methionine metabolism
boj00920  Sulfur metabolism
boj01100  Metabolic pathways
boj01110  Biosynthesis of secondary metabolites
boj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:boj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CBF45_15110
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CBF45_15110
Enzymes [BR:boj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     CBF45_15110
    2.3.1.46  homoserine O-succinyltransferase
     CBF45_15110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Esterase Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AZV94884
UniProt: A0A3T0NHY5
Position
complement(3419739..3421001)
Genome map
AA seq 420 aa AA seqDB search
MTPSSVSSNATGIGSCVAQDPLQAAIPAGSVGVVRAQKIAFDEPLQLVSGQVLPSYELAI
ETYGELNADRSNAVLICHALNASHHVAGINADNPKDVGWWDNMVGPGKPVDTNRFFVIGI
NNLGSCFGSTGPASINPATGKPWGAAFPVVTVEDWVHAQARVADYLGIERFAAVMGGSLG
GMQALSWAVTCPERVAHCVVIASTPRLSAQNIGFNEVARRAIITDPDFHGGDYYAHGTVP
ARGLSVARMVGHITYLSDDDMAEKFGRVQREPAANGDYHYGYDVEFEVESYLRYQGEKFS
RTFDANTYLLITRALDYFDPARRTGGDLARALAPATADFLLVSFTTDWRFPPERSREIVG
ALLQNDRSVTYGEINAPHGHDAFLLTDSRYHALVSAYFDRVARACRLGERQAPAQAGEQA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgactccttcatccgtatcttcaaacgccaccggcattgggtcgtgcgtggctcaggac
ccattgcaggctgccattccggcgggttccgtcggcgtggtccgggcacagaaaatcgct
ttcgatgaaccgctgcaactggtcagcggccaggtgctgcccagctacgagctggccatc
gaaacctatggcgagctcaatgccgaccgttccaatgctgtcctgatctgccatgcgctg
aacgcctcgcaccacgtggccggcatcaatgccgacaaccccaaggacgtggggtggtgg
gacaacatggtaggccccggcaagccggtggataccaaccgtttctttgtcattggcatc
aacaacctgggttcctgcttcggttccaccgggcctgccagcatcaatccggcgactggc
aagccctggggcgcggccttcccggtggtgactgtcgaggactgggtgcacgcgcaggct
cgcgtggccgattatctgggtatagaacgctttgctgccgtgatggggggctcgctgggt
ggcatgcaggcgctcagctgggccgttacctgcccggaacgggtggcccattgcgtggtg
atcgccagcacgccgcgcctgtcggcgcagaatatcggcttcaatgaagtagcgcggcgc
gccatcatcaccgaccctgatttccatggcggtgattactatgcccatggcacggtgcca
gcgcggggcctgtcggttgcgcgcatggtggggcacattacctatctgtcggacgacgac
atggccgaaaaattcggtcgggtccagcgcgagccggcggccaatggcgattaccactac
ggctatgacgtggaattcgaggtggaatcctacctgcgctaccagggcgaaaaattctcg
cgtaccttcgacgcgaatacctatctgctgattacccgagcgctggattatttcgatccg
gcgcggcgtaccgggggcgacctggcgcgtgcgctggcgcctgccacggcggatttcttg
ctggtgtcgttcacgactgactggcgtttcccgcccgagcgttcacgcgagatcgtcggc
gccttgctgcagaacgaccgctccgtgacctacggtgaaatcaatgcgccgcatggccat
gatgcgttcttgctgacggattcgcgctatcacgcgctggtatcggcctatttcgacagg
gtggcgcgggcatgccgcctgggtgaacgccaggcgccggcgcaggcaggagaacaggca
tga

DBGET integrated database retrieval system