KEGG   Burkholderia oklahomensis E0147: DM82_1469Help
Entry
DM82_1469         CDS       T03284                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00071  Fatty acid degradation
bok00072  Synthesis and degradation of ketone bodies
bok00280  Valine, leucine and isoleucine degradation
bok00310  Lysine degradation
bok00362  Benzoate degradation
bok00380  Tryptophan metabolism
bok00620  Pyruvate metabolism
bok00630  Glyoxylate and dicarboxylate metabolism
bok00640  Propanoate metabolism
bok00650  Butanoate metabolism
bok00900  Terpenoid backbone biosynthesis
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
bok01130  Biosynthesis of antibiotics
bok01200  Carbon metabolism
bok01212  Fatty acid metabolism
bok02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM82_1469
   00630 Glyoxylate and dicarboxylate metabolism
    DM82_1469
   00640 Propanoate metabolism
    DM82_1469
   00650 Butanoate metabolism
    DM82_1469
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM82_1469
   00072 Synthesis and degradation of ketone bodies
    DM82_1469
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM82_1469
   00310 Lysine degradation
    DM82_1469
   00380 Tryptophan metabolism
    DM82_1469
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM82_1469
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM82_1469
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM82_1469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bok04147]
    DM82_1469
Enzymes [BR:bok01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM82_1469
Exosome [BR:bok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM82_1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIO65320
UniProt: A0A088WT41
Position
1:complement(1669398..1670579)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERAGVKPEQISEVILGQVLTAG
SGQNPARQALIAAGLPSAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGVTAENVAKEYGITREEQDQFAA
LSQNKAEAAQKAGRFDDEIVPVEIPQRKGEPLRFATDEFVRHGVTAESLAGLKPAFAKDG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgtaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgacagtgatccgcgcggtgctcgagcga
gcgggcgtgaagccggagcagatcagcgaagtgatcctgggccaggtgctgacggcgggc
tcgggccagaacccggcgcgccaggcgctgatcgcggcggggctgccgagcgcggtgccc
ggcatgacgatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctcgccgcgaac
gcgatcgtcgcgggcgatgcggaaatcgtcgtcgcgggcggccaggagaacatgagcgcc
gcgccgcacgtgctgccgggctcgcgcgacggctttcggatgggcgacgcgaagctcgtc
gacagcatgatcgtcgacggcctgtgggacgtctataacaagtaccacatgggcgtcacg
gcggagaacgtcgcgaaggaatacggcatcacgcgcgaagagcaggaccagttcgccgcg
ctgtcgcagaacaaggcagaagccgcgcagaaggcgggccgcttcgacgacgagatcgtg
ccggtcgagatcccgcagcgcaagggcgagccgcttcgcttcgcgaccgacgagttcgtc
cgccacggcgtgacggccgagtcgctcgcgggcctgaaacccgcattcgcgaaggacggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tcggcgaagaaggccgaggcgctcggcctcgagccgcttgcgcggatcaaggcgtatgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggtcccgtgccggcatcacgacgctgt
ctcgagcgcgcgggctggtcggtcggcgatctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggtccacaagcagatgggctgggatacgtcgaaggtcaacgtg
aacggcggcgcgatcgcgatcggccatccgatcggcgcatcgggctgccggatcctcgtc
acgctgctgcacgaaatgcagaagcgcgatgcgaaacgcggcctcgcgtcgctttgcatc
ggcggcggaatgggcgtcgcgctcgcggtcgagcgtccgtaa

DBGET integrated database retrieval system