KEGG   Burkholderia oklahomensis E0147: DM82_1553Help
Entry
DM82_1553         CDS       T03284                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bok  Burkholderia oklahomensis E0147
Brite
KEGG Orthology (KO) [BR:bok00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DM82_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIO65446
UniProt: A0A381BP41
Position
1:complement(1763653..1764663)
Genome map
AA seq 336 aa AA seqDB search
MHSIQLALWAVAALVLVALVFDFMNGFHDAANSIATVVSTGVLKPQQAVVFAAAFNVIAY
FIFHLKVAQTVGKGTIDASIVDHYVVFGALFGAIGWNIITWYYGIPSSSSHALIGGLVGA
AVSKSGWGSLNIDGLMKTVAFIFISPLLGFVLGSLFMLGVSWLYFRTAPSKVDRRFRRLQ
LLSASLYSLGHGGNDAQKTIGIIWMLLIASGYASATSDAPPVWVIGACYLSMGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAETGGAVTLFVASWMGIPVSTTHTITGAIVGVGATRKLS
AVRWGVAGNIVWAWVLTIPASALIAAAGWWIGHRVF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcactcgatacaactcgccttgtgggccgtcgcggcgctcgtgctcgtcgcgctcgtg
ttcgatttcatgaacggcttccacgacgccgcgaactcgatcgcgaccgtcgtgtcgacc
ggggtgctgaagccccagcaagccgtcgtgtttgcggcggcattcaacgtcatcgcatat
ttcatcttccacctgaaggtcgcgcagaccgtcggcaagggcacgatcgacgcgagcatc
gtcgatcactacgtcgtgttcggggcgctgttcggcgcgatcggctggaacatcattacg
tggtactacgggattccgtcaagctcgtcgcacgcgctgatcggcgggctcgtcggcgcc
gcggtgtcgaagtcgggctggggatcgctcaacatcgacgggctgatgaagaccgtcgcg
ttcatcttcatctcgccgctcctcggcttcgtcctcgggtcgctgttcatgctcggcgtg
tcgtggctgtacttcaggaccgcgcccagcaaggtcgaccggcgcttcaggcggctgcag
ctgttgtccgcgagcctctatagcctcggccacggcggcaacgacgcgcagaagacgatc
ggcatcatctggatgctgctgatcgcatcgggctacgcgtccgcgacgtccgacgcgccg
cccgtgtgggtgatcggcgcgtgctacctgtcgatggggctcggcacgctgttcggcggc
tggcggatcgtccgcacgatgggccagaagatcacgaagttgaagccggtcggcggcttc
tgcgcggagacgggcggcgcggtgacgctgttcgtcgcgtcgtggatgggcattccggta
tcgaccacgcacacgatcacgggtgcgatcgtcggcgtcggcgcgacgcgcaagctgtcg
gccgtgcgctggggcgtcgcgggcaacatcgtgtgggcgtgggtgctgacgattcccgcg
tcggcgctgatcgcggcggccggctggtggatcggccaccgcgtgttctga

DBGET integrated database retrieval system