KEGG   Burkholderia oklahomensis E0147: DM82_1980Help
Entry
DM82_1980         CDS       T03284                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00860  Porphyrin and chlorophyll metabolism
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
Module
bok_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DM82_1980 (hemN)
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     DM82_1980 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C TonB_2 Thump_like
Motif
Other DBs
NCBI-ProteinID: AIO65952
Position
1:complement(2298244..2299695)
Genome map
AA seq 483 aa AA seqDB search
MDITTHSNDGTDTTAPPPHHDVSAFADVQISEALIRRFDRQGPRYTSYPTADRFSDTFDE
NAYREHLARRAAAERNPPLSVYLHLPFCESLCYFCACNKIITQDHSRTSAYVDYLIREME
LVAPHLGRDRVTTQLHLGGGTPTFFAIDELARLMRALRSHFDFAPHAELGVEIDPRTVDA
HTLQALAELGFNRTSFGVQDFDPSVQEAVHRIQPLPMVEHALAASRASGFESINIDLIYG
LPRQTPESFSRTLDEVIRLSPDRIAVYNYAHLPSRFKAQRLIDESALPLAEDRLRIFIES
TRRLLDAGYVYIGLDHFAKPTDELSNALRERSLHRNFQGYTTQAECDLLGFGISAIGKVG
ASYSQSTRSLKTYYRHLDAGRLPIERGFALTPDDLLRREIIMTVMCSTPLDFAVIGRKHG
IDFARHFAAELAQLEPYREAGLLTIDANRIAITPKGRMFVRAIGMVFDGYLGRPASASYS
KLI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggacatcacgacgcattcgaacgacggcacggatacgaccgcgccccctccccatcac
gacgtgtccgcgttcgcggacgttcagatttccgaagcgctgattcggcgcttcgatcgc
caagggccgcgctacacgtcgtatccgacggccgaccggttttccgacacattcgacgag
aacgcgtatcgcgagcatctggcgcgccgcgcggcggccgagcgcaatccgccgttgtcg
gtctatctgcacctgccgttctgcgagtcgctctgctatttctgcgcgtgcaacaagatc
atcacgcaggaccatagccggacgagcgcttacgtcgactacctgatccgcgaaatggag
ctcgtcgcgccgcatctcggccgcgaccgtgtgacgacgcaactgcatctcggcggcggc
acgccgacgttcttcgcgatcgacgagctcgcgcgcctgatgcgcgcgctgcgcagccac
ttcgatttcgcgccgcacgcggagctcggcgtcgagatcgatccgcgcacggtcgacgcg
cacacgctgcaggcgctcgcggagctcggcttcaaccggacgagcttcggcgttcaggat
ttcgatccgtccgttcaggaggcggtgcatcgcatccagccgctgccgatggtcgagcac
gcgctcgccgcgagccgcgcgtccggcttcgagtcgatcaacatcgatctgatctacgga
ctgccgcggcagacgcccgagagcttctcgcgcacgctcgacgaggtgatccggctgtcg
cccgatcgcatcgcggtctacaactacgcgcatctgccgagccgcttcaaggcgcagcgc
ctgatcgacgagtcggcgctgccgctcgccgaggatcggctgcgcatcttcatcgaatcg
acgcggcggctgctcgatgcgggatacgtgtacatcgggctcgatcatttcgcgaagccg
accgacgagctgagcaacgcgttgcgcgaacgcagtcttcatcgtaatttccagggctat
acgacgcaggccgaatgcgatctgctcggcttcggcatctcggcgatcggcaaggtcggc
gcatcgtacagccagtcgacgcgttcgctgaagacgtactaccgtcatctcgacgccggg
cgcctgccgatcgagcgcggcttcgcgctgacgcccgacgatctgctgcggcgcgaaatc
atcatgacggtgatgtgcagcacgccgctcgatttcgccgtgatcggccgcaagcacggc
atcgacttcgcacggcatttcgcggccgagctcgcgcagctcgagccgtatcgcgaagcg
ggcctgctgacgatcgacgcaaaccgaatcgccattacgccgaaggggcgcatgttcgtg
cgtgcgatcggcatggtgttcgacggctatctcggccggcccgcctcggcgtcctattcg
aagctgatctag

DBGET integrated database retrieval system