KEGG   Burkholderia oklahomensis E0147: DM82_2134Help
Entry
DM82_2134         CDS       T03284                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00540  Lipopolysaccharide biosynthesis
bok01100  Metabolic pathways
Module
bok_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DM82_2134 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bok01005]
    DM82_2134 (rfaD)
Enzymes [BR:bok01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     DM82_2134 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:bok01005]
 Unusual sugar
  DM82_2134 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: AIO67646
Position
1:complement(2459622..2460614)
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFVGANLVKALNERGETRIIAVDNLTRADKFKNLVDCEIDDYLDKTEFIER
FARGDFGKVRAVFHEGACSDTMETDGRYMMDNNFRYSRAVLDACLAQRAQFLYASSAAIY
GGSSRFVEAREVEAPLNVYGYSKFLFDQVIRRVMPSAKSQIAGFRYFNVYGPRESHKGRM
ASVAFHNFNQFSAEGKVKLFGEYNGYGPGEQTRDFVSVEDVAKVNLYFFDHPEKSGIFNL
GTGRAQPFNDIATTVVNTLRALEGKPSLTLAEQVEQGLVEYVPFPDALRGKYQCFTQADQ
TKLRAAGYDAPFLTVQEGVDRYVRWLFGQL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgttaccggcgcggccggcttcgtcggcgcgaacctggtcaaggcgctg
aacgagcgcggcgagacgcgcatcatcgcggtcgacaacctgacgcgcgcggacaaattc
aagaacctcgtcgattgcgagatcgacgactacctcgacaagaccgagttcatcgagcgc
ttcgcgcgcggcgatttcggcaaggtgcgcgcggtgttccacgaaggcgcctgttcggac
acgatggaaaccgacggccgctacatgatggacaacaatttccgttacagccgcgcggtg
ctcgacgcatgtctcgcgcagcgcgcgcagttcctgtatgcgtcgtcggccgcgatctac
ggcgggtcgagccgcttcgtcgaggcgcgcgaagtggaggccccgctcaatgtctacggc
tattcgaagttcctgttcgaccaggtgatccgccgcgtgatgccgagcgcgaagagccag
atcgcgggctttcgctacttcaacgtgtacggcccgcgcgagtctcacaagggccggatg
gcgtcggtcgcgttccacaacttcaaccagttcagcgccgaaggcaaggtcaagctgttc
ggcgaatacaacggctacggtccgggcgagcagacgcgcgatttcgtgtcggtcgaggac
gtcgcgaaggtgaacctgtatttcttcgatcatccggagaagtcgggcatcttcaatctc
ggcaccggccgcgcgcagccgttcaacgacatcgcgacgacggtcgtcaacacgctgcgc
gcgctcgaaggcaagccttcgctcacgctcgccgagcaggtcgagcagggcctcgtcgaa
tacgtgccgttcccggacgcgctgcgcggcaagtaccagtgcttcacgcaggccgaccag
acgaagctgcgcgcggccggctacgatgcgccgttcctgacggtgcaagagggtgtcgat
cgctacgtgcgttggctgttcggccagctgtaa

DBGET integrated database retrieval system