KEGG   Burkholderia oklahomensis E0147: DM82_3149Help
Entry
DM82_3149         CDS       T03284                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00360  Phenylalanine metabolism
bok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bok00790  Folate biosynthesis
bok01100  Metabolic pathways
bok01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DM82_3149 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DM82_3149 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DM82_3149 (phhA)
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     DM82_3149 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIO66532
Position
1:3554425..3555318
Genome map
AA seq 297 aa AA seqDB search
MSTVVTAKLKEQFDAGLETRADFTIDQPLARYGKVDHAVWKQLYTRQASLLRGRACDAFV
GGLARIDLSPERVPSFADVNRRLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGRAALAVADDPRALALLARLYWYTV
EFGLIRDARPENGLRIYGAGIVSSKGETLYSLESPAPNRIGFDLERVMRTRYRIDTFQKT
YFVIDDFAQLFALAHVDARALAARLADAPEHAAGAVLDGDRVLTRGTGEGWAIDEDA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcgtcaccgcgaaactgaaggaacagttcgacgcgggcctcgaaacccgt
gccgatttcaccatcgatcaaccgctcgcccgctacggcaaagtcgaccacgcggtgtgg
aagcagctctatacgcgccaggcgtcgctgctgcgcggccgcgcgtgcgacgcgttcgtc
ggcggcctcgcgcgcatcgacttgtcgcccgagcgcgtgccgtcgttcgccgacgtgaac
cgtcggctcgagcccgcgaccggctggcggatcgtcgccgtgccgggcctcgtgccggac
gccgtgttcttcgagcatctcgcgaaccggcggtttccggtcacctggtggatgcgtcga
ccggaccagctcgactacctgcaggagccggactgcttccacgatctgttcggccacgtg
ccgctcctgatcgatcccgtcttcgccgactacatgcacgcgtatggtcgcgcggcgctc
gccgtcgccgacgatccgcgcgcgctcgcgctgctcgcgcgcctctattggtatacggtc
gaattcggcctgatccgcgacgcgcgcccagaaaacgggctgcggatctacggcgcgggc
atcgtgtcgagcaagggcgagacgctctacagcctcgagagcccggcgccgaaccggatc
ggcttcgatctcgagcgcgtgatgcggacccgttaccggatcgacacgttccagaagacc
tacttcgtgatcgacgatttcgcacagctctttgcgctcgcgcacgtcgacgcacgcgca
ctcgccgcccggctcgccgacgcgcccgagcacgcggcgggcgcggtgctcgacggcgat
cgcgtgctcacgcgcggcacgggcgaaggctgggcgatcgatgaagacgcttga

DBGET integrated database retrieval system