KEGG   Burkholderia oklahomensis E0147: DM82_420Help
Entry
DM82_420          CDS       T03284                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00860  Porphyrin and chlorophyll metabolism
bok01100  Metabolic pathways
Module
bok_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DM82_420 (cobQ)
Enzymes [BR:bok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     DM82_420 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AIO66608
Position
1:491469..492929
Genome map
AA seq 486 aa AA seqDB search
MIQGTTSDAGKSTLVAGLCRLARRAGVRVAPFKPQNMALNSAVTADGGEIGRAQALQALA
AGIDAHTDLNPVLLKPTGDRGAQVIIHGKARANLNARAYHDYKPTAMQAVLESYGRLRGA
YDAVIVEGAGSPAEINLREGDIANMGFAEAVDCPVVLVADIDRGGVFAHLVGTLACLSDS
ERARIRGFVINRFRGDPALLEPGLRWLEQQTGKPVLGVLPYLHGLTLDAEDMLPASARTS
ASRRDAGVLRVVVPALPRISNHTDFDALRVHPRVDFTYWKSGPVPDADLLILPGSKNVLA
DLAWLRDAGWDALIKRHLRYGGKVIGICGGMQMLGRALDDPHGVEGAAGATSAGLALFDY
VTTLMPEKTLVNVAGRLAFADGARVSGYEIHMGQTRGPALASPALRLAGPGGERPDGAVS
ADGQMLATYLHGLFDTPDACAALLEWAGLGGAEPVDYPALREASLERLADTLAEHLDLDR
VFAAFA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgatccagggcacgacgtccgacgccggcaagagcaccctcgtcgcgggcctgtgccgg
ctcgcgcgccgcgcgggcgtgcgcgtcgcgccgttcaagccgcagaacatggcgctcaac
agcgcggtgacggcggacggcggcgagatcggccgcgcgcaggcgctgcaggcgctcgcg
gccggcatcgacgcgcacaccgatctgaaccccgtgctgctgaagccgacgggcgaccgc
ggcgcgcaggtgatcatccacggcaaggcgcgcgcgaacctgaacgcgcgcgcttaccac
gactacaagccgaccgcgatgcaggcggtgctcgaatcatacggccggctgcgcggcgct
tacgacgcggtgatcgtcgagggcgcgggcagtcccgccgagatcaacctgcgcgaaggc
gacattgcgaacatggggttcgcggaagcggtcgactgtccggtcgtgctcgtcgcggac
atcgaccgcggcggcgtgttcgcgcatctcgtcggcacgctcgcgtgcctgtcggacagc
gagcgcgcgcgtatccgcggcttcgtgatcaaccgctttcgcggcgatcccgcgctgctc
gagccggggctgcgctggctcgagcagcagacgggcaagcccgtgctcggcgtgctgccg
tatctgcacgggctcacgctcgacgcggaggacatgctgcccgcgagcgcgcgcacgtcc
gcttcgcggcgcgacgcgggcgtgctgcgggtcgtcgtgcccgcgctgccgcggatcagc
aaccacaccgatttcgacgcgctgcgcgtccatccgcgcgtcgatttcacgtactggaag
agcgggcctgtgcccgacgccgatctgctgatcctgcccggctcgaagaacgtgctcgcc
gatctcgcgtggctgcgcgacgcgggctgggacgcgctgatcaagcgccatctgcgctac
ggcggcaaagtgatcggcatttgcggcggcatgcagatgctcggccgcgcgctcgacgat
ccgcacggcgtcgaaggcgcggcgggcgcgacgagcgcgggcctcgctctgttcgactac
gtgacgacgctgatgccggagaagacgctcgtcaacgtggcggggcggctcgcgttcgcg
gacggcgcgcgcgtatcgggctacgagatccacatggggcagacgcgcgggccggcgctc
gcgtcgcccgcgctgcggctcgcggggccgggcggcgagcggccggacggcgcggtgtcg
gcggatgggcagatgctcgcaacctatctgcacggcctcttcgacacgcctgacgcgtgc
gcggcgctcctcgaatgggcggggctcggcggcgcggagccggtcgactatccggcgctg
cgcgaggcgtcgctcgagcggctcgccgatacgctcgccgagcatctcgatctcgatcgc
gtgtttgcggcgttcgcctga

DBGET integrated database retrieval system