KEGG   Burkholderia oklahomensis E0147: DM82_6139Help
Entry
DM82_6139         CDS       T03284                                 

Definition
(GenBank) thiJ/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    DM82_6139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bok01002]
    DM82_6139
Enzymes [BR:bok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     DM82_6139
Peptidases [BR:bok01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   DM82_6139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AIO69704
Position
2:complement(2823583..2824281)
Genome map
AA seq 232 aa AA seqDB search
MAIEVGLLLFPQVQQLDLTGPHDVFASLPGVTVRLVWKTREPVAASSGLVLAPNATFDDC
PPLDVICVPGGMGVADLMEDSDTLAFVRRHAAQARYVTSVCTGALVLGAAGLLRGRRATT
HWAFHSLLAPLGAIPVRERVVRDGNLVTGGGVTAGIDFALTLAAELVGEDDAQAVQLQLE
YAPAPPFESGDPDIAPAQIVERVRERSKPVLARREQVVERVAAALERSRAAE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaagtgggattactgttgtttccgcaagtgcagcaactcgatctgacgggg
ccgcacgacgtgttcgcgtcgctgcccggcgtcacggtgcggctcgtctggaagacgcgc
gagccggtggccgcgagcagcggactcgtgctcgcgcccaacgcgacgttcgacgactgt
ccgccgctcgacgtgatctgcgtgccgggcggcatgggcgtcgccgatctgatggaggat
tcggacacgctcgcgttcgtccgccggcacgcggcgcaagcgcgttacgtgacgtcggtc
tgcacgggcgcgctcgtgctcggcgcggcgggcctgctgcgcggccggcgcgcgacgacg
cactgggcgttccattcgctgctcgcgccgctcggcgcgattccggtgcgtgagcgcgtc
gtgcgcgacgggaatctcgtgacgggcggcggcgtgaccgcggggatcgatttcgcgctg
acgctcgcggcggagctcgtcggcgaggacgacgcgcaggcggtgcaactgcagctcgaa
tacgcgccggcgccgccgttcgaatcgggcgacccggacatcgcgccggcgcagatcgtc
gagcgcgtgcgcgagcggtcgaagccggtgctcgcgcggcgcgagcaggtggtcgagcgc
gtcgcggcggcgctggagcggagcagggcggcggagtga

DBGET integrated database retrieval system