KEGG   Brucella canis Oliveri: BCOUA_I0212Help
Entry
BCOUA_I0212       CDS       T03030                                 

Definition
(GenBank) unnamed protein product
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bol  Brucella canis Oliveri
Pathway
bol00730  Thiamine metabolism
bol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCOUA_I0212
Enzymes [BR:bol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BCOUA_I0212
Transcription factors [BR:bol03000]
 Prokaryotic type
  Other transcription factors
   Others
    BCOUA_I0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 NUDIX_4
Motif
Other DBs
NCBI-ProteinID: CDL75630
Position
I:complement(223710..224408)
Genome map
AA seq 232 aa AA seqDB search
MNLPQPHYSSELFTRLRTATLADWKPYIEHDFVRGLGDGTLPKAAFLHYLRQDYVYLHHY
ARAFALGVVKANTLQETRLCADIMHSLTHMELPLHVRICAREGISEDALYATREEPENLA
YTRYVLDCGQAGDFLDLLTALVPCAHGYGEIGLNLAATARAGTPYQEWIDTYAGSEYQDM
CRTVGRLFDQAARDRIGDDFEKSPRWPKLCQIFATASRLEADFWSMGLKAGS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgccacagccgcattactcatccgaacttttcacgcgccttcgcactgccacg
cttgccgactggaagccctatatcgagcacgacttcgtgcgggggcttggcgacggcacg
ctaccgaaagctgccttcctgcattatctccggcaggattatgtctatctgcatcattat
gcccgcgcctttgcgctgggcgtggtcaaggccaatacattgcaggaaacgcggctttgc
gccgacatcatgcacagtctcacccatatggaactgcctttgcatgtgcgcatctgcgcc
cgtgaaggcatcagcgaagacgcgctttacgccacgcgggaggaaccggaaaaccttgcc
tatacgcgctatgtgctcgattgcggacaggcaggcgattttctcgatctgctgacagca
cttgtgccttgcgcgcacggctatggcgagatcggcctcaaccttgccgccacggccagg
gcgggcacgccctatcaggaatggatcgatacctatgccgggtctgaatatcaggacatg
tgccgcacggtcggcaggcttttcgatcaggccgcaagggaccgcatcggcgacgatttc
gagaaaagcccgcgctggccaaaactctgccagatttttgccacggcaagcaggctcgaa
gccgatttctggtccatgggcttgaaggccggatcgtga

DBGET integrated database retrieval system